KEGG   Desulfosporosinus meridiei: Desmer_0282Help
Entry
Desmer_0282       CDS       T02207                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257827..258729
Genome map
AA seq 300 aa AA seqDB search
MQKKVVRIIGVPIDLGADRRGVDMGPSAIRYAGLNARLKRLGWIVEDYGNIDVPVPETRE
IKDKKLKYLEEIVQINEQLHLIVAKAKKDGVIPLILGGDHSLGIGTIAGLALSEQSFGLI
WFDTHGDYNTLDTTESGNIHGMPLAISNGLGAPELTGIGGNNKKLREENTVIIGAREMDP
QEKELLRRSKIKVFTMRDIDQMGMKEVVSEGIRIASQGTDGIHISFDLDVIDPEEAPGVG
TPVPGGITYREAHLAMELLADSGYISSMDVVEVNPILDNHNKTAKLAVGLICSAFGERIF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaagtagttagaattattggggttcccattgatttaggtgctgatcgtcgt
ggagtagatatggggccaagtgctattagatatgccggattaaacgccagattaaagcgt
ttaggatggattgtcgaggactatggtaatatcgacgttccagttccggagacaagagaa
ataaaagataaaaagctaaagtatttggaggagattgtacaaattaatgagcaacttcat
cttattgtcgctaaagcaaaaaaggacggtgttatcccactgattcttggtggagatcat
agtttaggcattggaacaatagcagggctggctttaagtgaacagtcctttggattaatc
tggtttgacacccatggagattataatactctcgatacaacagaaagtggcaatattcat
ggtatgcccttagcaatatctaatggactcggggctcctgaattaacgggaattggtggg
aataataaaaagttgagagaggaaaatacagtcattattggcgctagggaaatggatccc
caggaaaaagaattacttcgcagatccaagattaaggtttttacaatgagagatatagat
cagatgggaatgaaggaagttgtctccgaagggatcagaatagcttctcaaggaacggat
ggaatacatataagcttcgatttagatgtcattgatccagaggaagcccctggagttgga
actccggtaccggggggcatcacgtatcgagaagcacatttagcgatggaactgttagca
gactcggggtatatatcaagtatggatgttgtagaagtgaatccaattttagataatcat
aataaaaccgctaaattggcagtagggcttatttgttctgcatttggagagcgaattttc
tag

DBGET integrated database retrieval system