KEGG   Desulfosporosinus meridiei: Desmer_0610Help
Entry
Desmer_0610       CDS       T02207                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:4.4.1.15)
Organism
dmi  Desulfosporosinus meridiei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(630829..631824)
Genome map
AA seq 331 aa AA seqDB search
MNKLQLAKLPLPARISLMNSPTPLQKSRLAWGKDSLHWKRDDLTPFGLGGNKLRKLEFLL
ADALNHKADLIITSGAPQSNHARLTAVISAMLNLSSIIVIPGEMPSEWGGNLLLDRLAGA
EIIACGEEPLAEAVERISSERSFQGRHPYIIPLGGSNALGSMGYFLAFFELMEQAKEQGW
TPKTLVCSVGSAGTLAGLVAANTLLPQPLRLIGVNVISISDQLYSRVQQLASEILDLLQT
SCPLPTFEITSDFIGAGYGLPTPPSSEVIIECFRTDGILFDPVYTAKGVAAVKNLMQQKS
RELPEEIVFWHTGGGPAIFDQHYYTDLLNYT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattgcaattagcaaaattgcctcttccagctcgaatctctttaatgaattct
cctaccccccttcaaaaaagtcgccttgcctggggcaaggattccttacattggaagcgg
gatgacctgacaccctttggccttggaggaaacaaactgcgcaaattagaatttttattg
gccgatgctttaaatcacaaggcagatctcattatcacatccggagcaccccagtccaat
cacgcccgactcactgctgtaatttcagcaatgctaaacctctcgtccatcatagttatc
ccaggagagatgccctccgaatggggcggcaacctcctcttagatcgcttagccggcgcc
gaaatcattgcctgcggtgaagaacctcttgctgaagcagtggaacgtatttcttctgaa
aggagcttccaaggccgccatccttatataattcccctcggtggctcaaatgcccttggg
tccatggggtatttccttgcttttttcgagcttatggagcaagcaaaagaacaaggctgg
actcctaagactcttgtctgctccgttggcagcgcagggactctggctgggttagttgcc
gccaatacccttttgcctcaacctcttcgtctcataggagtcaacgtcatatcgatttcg
gatcaattatattctcgggtacaacagctagcctctgaaatcttggacttgctccaaacc
tcttgtcctctacccacttttgagattacctccgactttattggagcaggatatggctta
cccacgcccccctcttctgaggtcataattgagtgttttcgaactgacggtatcctcttt
gatcccgtctatactgccaaaggagtcgcagcagtcaaaaacctcatgcagcagaaaagc
agagaacttccggaggagattgttttttggcatactggaggcgggccagccatctttgat
caacattattacactgatcttcttaactatacctga

DBGET integrated database retrieval system