KEGG   Desulfosporosinus meridiei: Desmer_0663Help
Entry
Desmer_0663       CDS       T02207                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Desmer_0663
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Desmer_0663
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Desmer_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
682547..683089
Genome map
AA seq 180 aa AA seqDB search
MSIYDYSFQSIEGKTVSLSDFQGKVMLIVNTASKCGFTPQYEGLEKLYEAYKDQGLVVIG
FPCNQFAEQEPGTNSEVQEFCKIRYGVTFPLTEKVNVRDENADPIFQYLTENTTFKGLGK
GLKNKALELMLKQKYGKQFSDNSVKWNFTKFLIGRDGKIAGRFEPTVSPESMVSSIEECL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgattattcatttcagtccatcgaaggtaaaacagtctctctttctgat
tttcaaggtaaggtgatgttgattgtcaacaccgccagcaaatgcggttttactccccaa
tatgagggactagagaaactttatgaagcttataaagatcaaggtttagtggtgatcggt
ttcccctgtaaccaatttgctgagcaggagccggggaccaatagtgaggttcaggagttt
tgtaagataagatatggggttaccttcccgcttacggaaaaggtgaatgtacgggatgaa
aatgctgatccaatctttcaatatcttactgaaaacacaacctttaaggggttaggtaaa
ggccttaaaaacaaagcccttgaacttatgctcaaacagaaatacggaaagcagttctct
gataactctgttaaatggaactttacaaaattcctcattggcagagacggaaaaatagca
ggccgttttgagcccactgtctcaccggaaagcatggtatcctcgattgaggagtgcttg
taa

DBGET integrated database retrieval system