KEGG   Desulfosporosinus meridiei: Desmer_0665Help
Entry
Desmer_0665       CDS       T02207                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmer_0665
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_0665
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desmer_0665
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desmer_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683964..685193
Genome map
AA seq 409 aa AA seqDB search
MVKEKLHVLSDGGYETKGHFGPYGGAYVPETLVPALRELEEAYMRSGRDESFQKEFRDLL
QRYVGRPSLFYEAKRLSEQLGGARIYLKREDLNHTGAHKINNTLGQILLAKAMGKKRVIA
ETGAGQHGVATATACALFALPCVVYMGEEDVRRQKLNVLRMKLLGAEVRTVTHGSCTLKD
AINEALRDWVTNVEETFYCFGTAAGPHPYPTIVRDFQAVIGHETREQALKELGKLPDAII
ACIGGGSNAIGIFHPFISDPEVRLIGVEAGGTGNKTGENAATLCLGEPGVLHGAYSYLLQ
DDDGQIVVTTSVSAGLDYPGVGPEHSNLKETGRADYVSISDQEALDACSLLCQTEGILPA
LESAHAIAYAAKLAPRLSKDQVIVVNLSGRGDKDVETLAQYLEGGADHE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaaaagttacatgtactgtctgatggcggctacgaaacaaaggggcatttt
ggtccatatggaggtgcctatgttccagagaccttagttcctgctttgcgagaattagaa
gaggcctacatgagatctggccgagatgagagctttcagaaagagtttcgagacctgtta
caaaggtatgttggacgaccatctttattctatgaagccaagcgcttatcagaacaattg
ggtggtgcccgaatttatcttaaaagagaagatctcaatcataccggtgcacataaaatt
aacaacactttagggcagattttgctcgctaaagctatgggtaagaaaagagtgattgct
gagacaggagcaggacagcatggggtagctactgctacggcttgtgcattatttgctctt
ccgtgtgtagtttatatgggagaagaagatgttcgccgacagaagttaaacgtcttgcgg
atgaagttattgggtgcagaggttcgtactgtgactcatggatcatgtactctaaaagat
gctattaatgaagcactgcgggactgggtgactaatgttgaggagacgttttattgcttt
gggacggcagccggaccacatccctatccaacaattgttcgagattttcaggcagtaatt
ggacatgagaccagggagcaagccttaaaggaattaggaaaacttccagacgcgatcatt
gcctgtattggaggtgggagtaatgccattggtatcttccatcctttcatctccgaccca
gaggtaagactaattggagtcgaagcagggggaacaggaaataagacgggggaaaatgct
gcgacactttgtttgggtgaacccggtgttttgcatggagcttatagctatttgctgcaa
gatgatgatggacaaattgttgtaaccacatctgtctctgccggacttgactatcccggc
gtaggaccagagcacagcaatctgaaggaaacgggtcgagcagactatgtcagtatttcg
gatcaagaagcgttagatgcttgctccttgctttgtcagactgagggaatcctgccggcc
ctggaaagtgcccatgccatcgcctatgcagctaaacttgcccccagactctcgaaagat
caagtgatcgtagttaatctttcgggcagaggagataaagatgtagaaaccttagctcag
tatttagaaggaggtgcagatcatgagtga

DBGET integrated database retrieval system