KEGG   Desulfosporosinus meridiei: Desmer_0666Help
Entry
Desmer_0666       CDS       T02207                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmer_0666
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_0666
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desmer_0666
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desmer_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
685186..686001
Genome map
AA seq 271 aa AA seqDB search
MSERLKAVFQTKPAGVTRLISYIMAGDPTVEVSLRRLRGLADHGVDVLELGVPFSDPMAD
GVVIQAAAERALNAQMTVKKTLELVEEFRKTHNTPLLLMSYLNPLLRYGWDRFVEDAAEA
GVDGFILPDLPWREGQGLRTRTEKSVGNKLSFIPMIAQTSREQDIEAVSQVTEGFAYVLS
RNGITGGEVEIPDNVSVFIESLRDSLQIPRCVGFGIQKAEQVRALAKICDGVVVGSALVK
AFAKLDQEGLEEKDLIEQEKEVFTWLASLKQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagagacttaaggcggtttttcaaactaaacctgcaggggtaactcgtctgatt
tcatatattatggcgggagatcctaccgtagaggtcagtctgcgacgcctaagggggctg
gctgatcacggagtggatgttttagaactgggagttcccttcagtgatccaatggccgat
ggggtggtgattcaagctgcggctgagagagctttaaatgctcagatgacggtgaaaaaa
accttagaactggtagaggaatttcgtaaaactcacaacaccccccttcttttgatgagt
tatctgaacccacttcttcgttatgggtgggatcgatttgttgaagatgcagctgaggca
ggagtcgatgggtttatcttaccggatttaccttggagggaaggtcaagggcttagaaca
agaactgagaaaagtgtcggtaacaaactatcttttatcccgatgattgcccaaactagc
cgtgagcaagatattgaggctgtctctcaggtaaccgaaggatttgcttacgttctatcg
cgtaatgggattaccggaggagaagttgaaatccctgacaacgttagcgtgtttatagaa
agcttgagggatagccttcaaatcccgcgttgtgtcggttttgggattcagaaagccgaa
caagtccgtgcattagcaaaaatttgcgacggagttgtcgttggcagtgctttagtaaaa
gcctttgccaaacttgatcaagagggattagaggaaaaagacttaatcgagcaggaaaaa
gaagtatttacttggttggcaagcctgaagcagtag

DBGET integrated database retrieval system