KEGG   Desulfosporosinus meridiei: Desmer_0900Help
Entry
Desmer_0900       CDS       T02207                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dmi  Desulfosporosinus meridiei
Brite
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Desmer_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941973..942662
Genome map
AA seq 229 aa AA seqDB search
MNKEYSIDAYSERRAEREWMVHTQLVSRDITDETVINSMSLVPRHKFVREDKQDLAYYDT
PLEIDSGQTISQPYMVALMAQALSLKASDRVLEIGTGSGYSAAILSRIALRVYTIERHQV
LASLAEERFRKQGYKNIEVRVGDGTLGWQEKAPFDAILVTAGGPVIPDPLLDQLAVGGRL
VIPVGERGEQSLLRLKKTMSGKLITENLGGVRFVPLIGMRGWDERIKNS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaagaatatagtatagatgcttattcagagcgtcgggctgaacgtgagtggatg
gttcatacgcagctcgtaagtcgagacataacagatgagactgttattaatagcatgtct
ttggttccaaggcacaaatttgtcagagaggataaacaagacttagcctattatgatact
ccactggaaatagattctggacagacaattagtcagccgtatatggttgctctgatggct
caggccttaagcttaaaagcaagtgaccgagttttggaaataggaaccggttctggttat
tcagcagcgattttatctcgaattgccttgagggtttatacaatagaacgacatcaagta
cttgctagcttggcggaggaacgatttagaaaacaagggtataaaaatattgaagtaaga
gttggggatggaactctggggtggcaagagaaggcaccctttgatgcaatcttagttact
gcaggagggcctgttattccggatcctttactggatcaactagctgtcggaggccgcttg
gtgattccggttggggagaggggagagcagagtttattgcgtttaaagaaaacaatgtcc
ggtaaattgataactgaaaatctgggaggagtgcgttttgttccgctaattggaatgagg
ggatgggatgaaagaataaagaatagttag

DBGET integrated database retrieval system