KEGG   Desulfosporosinus meridiei: Desmer_0925Help
Entry
Desmer_0925       CDS       T02207                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968279..968881
Genome map
AA seq 200 aa AA seqDB search
MIGMLRGKVWEIQGERLVMDVQGTGYLLTVPYGLLAKIHPGQELIVYTHVVMREDDLSLY
GFSSFEEKQLFLQMLSVSGIGPKAAISLLSTFGAIQIESAIASENLNLLTKVPGIGKKTA
QRLILELKEKFKGHNLAANESGSFSEPLSQSHSEAQETLLALGFGLEEARQALSRALKDG
GELTTEEQVKKALRFLASGH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattggaatgttgcggggcaaggtttgggaaatccaaggtgagcgtttagtgatggat
gtacagggcactgggtacctgctgacggttccctatggacttttagcaaagatacacccc
gggcaagaacttatcgtctacactcacgtggttatgcgtgaagacgatttatctctttac
ggtttttcttcatttgaagagaaacagctctttcttcaaatgttaagtgtttcaggaatt
ggtcccaaagcagctatatccctactttcaacctttggagcgatacagattgaaagcgcc
attgcaagtgaaaatcttaacttgttaacaaaggttcctggtatcggaaaaaagacagcc
cagcggctaattctagaactgaaagagaaatttaaagggcataatttagctgctaatgaa
agcggttcgttttctgaacccttgtctcagagtcactctgaagctcaggaaaccctactg
gctttaggatttggcttggaggaagcacgtcaggctctgagccgggccttaaaagacggc
ggggaattgacgacggaggagcaagtaaagaaggcactgcgttttctcgcctccgggcac
taa

DBGET integrated database retrieval system