KEGG   Desulfosporosinus meridiei: Desmer_0968Help
Entry
Desmer_0968       CDS       T02207                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmer_0968
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_0968
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desmer_0968
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desmer_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1008693..1009868)
Genome map
AA seq 391 aa AA seqDB search
MEKGYFGEFGGSFVPPQLENALAQLDDAFETHKNDPDFNQELDYYLRQYVGRPNPLYYAK
KLTQQLGGAKVYLKREDLNHTGAHKINNVLGQALLAKRMGAKRVIAETGAGQHGVATATA
CALFDMECIIYMGEEDTKRQSLNVFRMELLGAKVVPVTSGTRTLKDAVDAALEDFAVNYE
NTFYMLGSAVGPHPFPSLVKHFQAVISREARQQILEAEGKLPDVVMACVGGGSNAIGMFA
NFLEDSSVKLIGVEPAGLGLETGKHAAPLSAGAPGIVHGFKCYVMADENGEPLATHSISA
GLDYPGVGPEHSYLKDSGRAEYVSITDTESLEAFHRLSRTEGIIPALESAHAVAYALKLA
PTMNPNEIIIVNISGRGDKDVEQIYQLTHKS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggatatttcggagaatttggcggtagttttgttcccccccaattagaaaat
gccttagctcaattagacgatgctttcgaaacccataagaatgatccggattttaatcag
gagcttgactactatttacggcagtatgtaggccgccccaaccctctctactatgccaaa
aagcttactcaacaattaggtggtgctaaagtatacctgaaacgtgaagaccttaaccat
accggggcccacaagattaataatgttcttggtcaagcattgctggcgaaacgtatggga
gctaaacgggtcattgctgaaaccggtgccggacaacacggcgtagcaacagcaacagca
tgcgctctctttgacatggaatgcattatatatatgggagaagaagataccaagcgccaa
tccctcaacgtcttccgcatggaactcctgggggcaaaagttgtcccggtcacatcggga
acacgtactttaaaagatgctgtggatgcagccttagaggactttgccgtaaattatgag
aacaccttttacatgctgggttcggcagtaggcccccatccttttccttcacttgtcaaa
cacttccaagcagttatttcccgggaagcacgccagcaaatactcgaggccgaaggaaaa
cttcctgatgtagtgatggcctgtgtcggcggcggcagcaacgctatcggtatgttcgcc
aatttcttagaagactcctccgttaaactcataggagttgagccggcaggtttaggtctg
gaaaccggcaaacacgctgctcctctgtccgccggagctcccggaatcgttcacggcttt
aaatgctacgttatggcagacgaaaacggagaacctctggccacccactccatatccgcc
ggcctggactatcccggcgttggaccggagcatagttatctgaaggacagtggtcgtgca
gagtatgtaagcatcactgacaccgagtccctggaagccttccaccgactttcccgaaca
gaaggtatcattcctgccctggaaagcgctcatgctgtagcctacgccctgaaacttgct
ccaaccatgaaccccaatgaaattatcatcgttaatatctccggtcgcggtgacaaagat
gttgaacaaatctatcaactaactcataaatcttag

DBGET integrated database retrieval system