KEGG   Desulfosporosinus meridiei: Desmer_1182Help
Entry
Desmer_1182       CDS       T02207                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dmi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dmi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229887..1231680
Genome map
AA seq 597 aa AA seqDB search
MGGYIGKILRVNLTEGKISTEPLNMELAKKYLSGRGLAGKMFTDEVASDVDALSPENKIF
IAAGALTGTNAPTSGRYVVVTKSPLNGVVASSNSGGQWGAHMKFAGYDMVILEGKADRPV
YLSIHDDVVEIKDAAHVWGKDVYATTDTLKKEFGDDKVKVLSIGPAGENLSLISAVMNDL
YRAAGRSGVGAVMGSKNVKAILVRGTGKVENANPDVMKTVLSSALGKLRENGVTGQGLPT
YGTAVLVNIINESGIYPVKNFQESYDAEADLISGETMTANHLIKKDPCYRCPIACGRYSK
WEGGEGAGPEYETVWVFGSNSGIHDFDAIHKANDLCNKLGLDTISVGATIAAGMELVQRG
YIKPEELDGTPLEFGNAAGMVEWVRKIGYAEGLGAKMALGSYRLAESYGAPELSMTVKKL
EIPAYDPRGVQGQGLQFATSNRGGCHVRGYMISPEILGLPEKLDRTSLEGKATWVKIFQD
LTAVIDSLGLCLFSSFALGLSDYAALVNAVTGANYTDEELLACGERIWNNERLHNLRVGY
SAAEDTLPKRLIQDPIVDGPSKGQVLKLAELLPKYYAERGWDEAGVPTPECLTKLGM
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggtatatcggaaaaatattacgtgttaatctcacggaaggaaaaatcagtact
gaacctttaaacatggaacttgcaaagaagtatttaagtggacgtggtcttgccgggaaa
atgtttacagatgaggtagcttcagacgttgatgccctttctcctgagaacaagatattt
attgctgccggtgctctgacaggaaccaatgctccaacctcaggtcgttatgtagtagtg
acaaagtctcccttaaatggtgtagtggcctcttcaaactcaggaggacaatggggcgct
catatgaaatttgccggttatgatatggtcatcttagaaggcaaggctgaccggcccgtt
tatctaagcattcatgatgatgtagtagagattaaggatgcagctcacgtttggggcaaa
gatgtctatgccacaactgataccttaaaaaaggaatttggagatgacaaggttaaagtc
ttatccatagggcctgccggtgagaacctttcattaatatctgctgtcatgaacgatctt
tacagagctgcaggacgcagtggcgtcggtgctgttatgggttccaaaaatgttaaggca
attttggttcgtggaacgggtaaagtagaaaatgccaatccggatgtaatgaaaactgtc
ttaagctcagctttaggcaaacttagagaaaatggtgtaacaggtcaaggacttcccact
tatggaaccgcggttttggtcaatattatcaatgaaagtggtatttatccggttaagaac
ttccaggaatcctatgatgctgaggcggatttaatcagtggtgaaaccatgactgcaaat
catctgattaaaaaagacccttgctatcgctgcccgattgcctgtggacgttatagcaaa
tgggagggtggcgaaggtgccggtccggagtacgaaacagtgtgggtattcggttcgaac
tcaggtattcacgactttgatgcaattcataaagctaatgatttgtgtaacaaattaggt
ttagacacaatttccgttggagctacaattgctgcaggtatggaattagtgcagagaggc
tatattaagcctgaagaacttgatggcacaccccttgagttcggcaatgcagcgggaatg
gttgaatgggttcgcaaaattggctatgcggaaggcttaggggccaaaatggctttaggt
tcctatcgtttagctgaaagctatggtgctcctgaactgtccatgactgtgaaaaagtta
gaaattccagcctatgatccaaggggagtacaaggtcagggtcttcaatttgctaccagt
aatcgtggaggctgtcatgttcgtgggtatatgatttctccggaaatcttaggattacca
gagaagcttgaccgtacttcattagaaggaaaagcaacttgggttaagatattccaagac
cttacagcggtcatcgactccctgggactatgtttattctcctcctttgccttaggtctt
tcggattatgctgccctagtaaatgcagtgacaggtgccaattatacagatgaagaactc
ttagcctgcggagaaagaatttggaataatgaacgcttgcataatttgcgcgtcggatac
tctgctgctgaggacacccttccgaagcgtttaatccaagacccaattgtagatggtcct
tccaaaggccaagtcctcaaattggcagagcttctgcctaagtactacgctgagcgtggt
tgggacgaagcaggggtgcctacgcctgagtgcctgacaaaactaggaatgtaa

DBGET integrated database retrieval system