KEGG   Desulfosporosinus meridiei: Desmer_1209Help
Entry
Desmer_1209       CDS       T02207                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desmer_1209
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Desmer_1209
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Desmer_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1257081..1258586
Genome map
AA seq 501 aa AA seqDB search
MSKGYVYLVGAGPGDPKLITIKGSECIAKADVLVYDRLASRRLLTLARPDCELIYVGKSP
DRHTLRQEEINQVLVDKGLEGKIVTRLKGGDPFVFGRGGEEAEALLKAGIQFEVVPGITS
AIAVPAYAGIPVTHRDLTSSFAVITGHEDPTKNETSIHWDHLAQSHGTLVFLMGMENLPL
IAQKLMENGKKPTTPVGIIQWGTRPEQRTLVGQLDTIAEEVKKQNFTNPSIIIVGEVVSL
REKLQWFEKKPLFGQRIVVTRARHQASVLTQEIEALGGEAWEFPTIDIAPPTDNAALINA
IKNLREFQWLIFTSVNGVEAFFDELSIQERDVRELIGVEIVAIGPATQASLEKRGLRAAY
VPEEYKAEKIVEGLTSRVAKGQKVLLARAEEARDVLPVSLKAMGVEVSDVPVYKTVLGGA
NSGELKRMLAEQEIHKVTFTSSSTVRNFMELLDGEISLLNGVLLYSIGPITSATARKLGL
TIYKEAKEYTIPGLVNALMEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagggatatgtatatttagtgggtgccggtccgggagaccctaagttaattacc
attaaggggtcggagtgtatagccaaagcagatgtgttagtttatgatcggttagcttca
cggcgccttttgacgttagctcgtccggattgtgagctcatctatgtggggaaatccccg
gatcgccacacacttcggcaggaagaaattaatcaagttcttgtggataaaggcttagag
ggaaaaatcgtgacccgtcttaaaggtggggatccttttgtttttggcaggggaggcgag
gaagcggaagctttgctcaaggcagggattcaatttgaagtagttcccggcattacctcg
gccattgcagttccggcttatgctgggattccggtaactcatcgtgatctcacatcttct
ttcgcagttataacagggcacgaagatcctaccaagaatgagaccagtattcattgggat
catcttgcccagtcccatggtaccttggttttcctaatgggcatggagaatctccccttg
attgcccaaaagttaatggaaaatgggaagaagccgacgactcctgtgggaattattcaa
tgggggacaaggccggaacaaagaactttggttgggcaattggatactattgccgaagag
gttaaaaaacagaacttcactaatccttcaatcataattgttggagaggttgtatccctt
agggagaaactccaatggttcgaaaagaagccattgtttggtcaaagaatcgttgttact
cgtgcacgccaccaggccagcgtactgacgcaagaaattgaagccttaggcggagaggcg
tgggagttcccgacgatcgatatcgcgcctcccactgataacgcagccttaattaatgct
atcaaaaacctaagagaattccagtggcttatttttaccagtgttaatggggtagaggct
ttcttcgacgagttaagcattcaagaacgggatgtgcgggagcttatcggcgtggagata
gttgccataggcccagctacccaagcttcgttagagaaaaggggacttcgtgctgcttat
gttcctgaagagtataaagcagagaaaattgtggaaggtctgacaagcagagttgccaaa
gggcaaaaggtattgctggccagggccgaagaagctagggatgttttgcctgtatctctc
aaggctatgggtgtggaagtctcggatgtcccagtctataagacagttctggggggagca
aatagtggggaattgaaacgaatgcttgctgagcaggagattcacaaggttacctttacc
agctcgtcaacggtacgaaattttatggagcttttggatggagaaatatcgttgctgaac
ggtgtcttactttactcaattggtccaatcaccagcgctacagctcgaaagctgggtttg
actatctataaagaggcgaaagagtatacgattcccggactagttaatgccttaatggag
gagtga

DBGET integrated database retrieval system