KEGG   Desulfosporosinus meridiei: Desmer_1211Help
Entry
Desmer_1211       CDS       T02207                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00860  Porphyrin and chlorophyll metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desmer_1211
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desmer_1211
Exosome [BR:dmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desmer_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFQ43228
JGI: DesmerDRAFT_1211
UniProt: J7IVR4
Position
1259823..1260800
Genome map
AA seq 325 aa AA seqDB search
MELIRRPRRLRVNETIRNMVRENHLRVENLIYPMFVMPGEKKRVEISSMPGVYNYSLDEF
ILALKEVVELGIPSVLLFGIPESKDSVGSGAYHEQGIVQQAVRLAKEHYPNLYIITDVCL
CEYTDHGHCGLIEKGQVLNDPTLDLLAKTALSQVKAGADMVAPSDMMDGRVAAIREMLDL
EGFTNIPIMAYSAKFASGFYGPFREAAGSTPQFGDRRTYQMDPANGNEAMLETDLDIEEG
ADMVIVKPAMSYGDIIYRTKERYGIPVAAYNVSGEYAMVKAAAANGWIDEKRIVLEALLS
MKRAGADLLITYHALDVAGWLREEG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaattaatcaggcgtccccgccgtttacgggttaacgagacaatccgtaatatggta
cgagaaaatcatcttagagtagagaatttaatttatcccatgtttgtgatgcccggcgaa
aagaaaagggttgagatatcctcaatgccgggagtatataactattcccttgatgaattt
atccttgctcttaaggaagttgtagaacttggaattccctcggtactgctctttggtatc
ccggagagcaaagatagtgtgggatcaggggcttaccatgagcaaggaattgtccaacaa
gctgtacgtctagccaaagaacattaccccaatctttatatcatcacggatgtctgcttg
tgtgaatacacggatcatggacattgcggcttgatagaaaagggtcaggttttaaatgac
ccaacccttgacctgcttgctaagacagcactttcccaggtcaaagcgggagcagatatg
gttgctccttcggacatgatggatgggcgtgtcgcagcaatcagagaaatgttagacctg
gagggcttcactaacattccaattatggcttactcggccaagttcgcatccggattttac
ggtccttttcgcgaggcagcaggatcaacaccgcaatttggagatcgcagaacttatcag
atggatcctgctaatggcaatgaagctatgctcgagacggatttagacattgaagaaggg
gcagacatggttatcgtcaagccggcaatgtcctatggagatattatttatcgaaccaaa
gagcgctacggtataccggtggcagcttataatgtcagcggagaatatgccatggttaaa
gccgctgctgctaacggctggattgatgagaaacgcatagttttggaggcccttttgagt
atgaaacgtgccggagccgatttgctgatcacctatcatgccttagatgtggcgggatgg
cttagagaggagggttaa

DBGET integrated database retrieval system