KEGG   Desulfosporosinus meridiei: Desmer_1292Help
Entry
Desmer_1292       CDS       T02207                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00260  Glycine, serine and threonine metabolism
dmi00750  Vitamin B6 metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01230  Biosynthesis of amino acids
Module
dmi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_1292
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desmer_1292
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desmer_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR HypA
Motif
Other DBs
NCBI-ProteinID: AFQ43303
JGI: DesmerDRAFT_1292
UniProt: J7IW30
Position
1343157..1344398
Genome map
AA seq 413 aa AA seqDB search
MKNVLGLRCIDCGKQVPAVAGTYTCPTCGKTGGIMDVEYDYKVINQMTSREQLAQSKDYS
IFRYMPFLPIGPDSARPHLRVGWSPLYKPQGLGKSLGMSNLYVKDDGQNPTASLKDRASI
IAVIKAVEEKAPTVAASSTGNAASSLAGSAAAMGIKSVIFVPSRAPQGKVAQLLIFGATV
ISVQGSYEDTFRLSAEAIERFGWYNRNAAINPYLVEGKKTVALEIAEQLNWEVPDWVILS
VGDGCTIAGVWKGFKDLYNAGWIDRLPKIAGVQSTGCCPLVDAFVENRPWRPKEENTIAD
SIAVGVPRNPDKALNAVRESGGTMVAVSDEEILAAMRELGRTSGIFGEPAGVTGTAGLKV
LVEKGVIGADEKVVSIVTGNGLKDVQNAIKAVGEPIRVEPSLKELLVKLEGKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtgttaggactgcgctgcattgattgcggaaagcaagtcccagcagtggcg
ggaacctatacctgcccgacgtgtggcaaaaccggcggcatcatggatgtggaatacgat
tacaaggtgattaaccaaatgacatcccgtgagcagctagcccagtcgaaggactattcg
atttttcgctacatgccttttctgcccatcgggccggattctgcccgccctcatttgaga
gttggctggagtcctctttataaacctcagggtttgggaaaaagcttaggtatgagtaat
ctttatgtcaaagatgacggtcagaacccgacggcatctcttaaagatcgagcttcgatt
attgctgttattaaagctgtcgaagaaaaggcccccacagttgccgcatcttctaccggt
aatgcagcctcctccttggctggcagtgcggcggctatgggtattaagtccgtaatattt
gtgccaagccgtgcacctcaaggaaaggtagctcaattactgatttttggagctacggtc
atcagtgttcaaggatcttatgaagatacattcagactatccgctgaggcgattgaacga
tttggctggtataaccgcaatgcggctatcaatccctacctggttgaaggtaaaaagaca
gttgccctggaaattgccgaacaattaaactgggaggtgccggattgggttatcctttcc
gttggggatggctgtacaatagcgggggtctggaagggctttaaggatctttataatgca
ggctggattgaccgcttaccgaaaatcgcgggagtgcagtcaactggctgttgtccactg
gtagatgcttttgtggaaaatcgtccttggcgtcccaaggaagagaacaccatcgctgat
agtatcgctgtcggtgtgcctcgtaatccggataaggctttaaatgcagttcgggaatcc
ggtgggacaatggttgctgtgtcagatgaggaaatcctggcagccatgcgagaactgggt
agaaccagcggcatttttggcgagccggcgggagtaacaggaactgccggacttaaggtc
ttggtggaaaaaggcgtgattggcgccgacgaaaaagtagtatcaattgtcaccggtaat
gggttaaaggacgttcaaaacgccattaaagcagttggtgagccgattagggttgagcct
tcccttaaggaactgctggttaagctcgaaggaaaagtctga

DBGET integrated database retrieval system