KEGG   Desulfosporosinus meridiei: Desmer_1292Help
Entry
Desmer_1292       CDS       T02207                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmer_1292
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_1292
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desmer_1292
Enzymes [BR:dmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desmer_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1343157..1344398
Genome map
AA seq 413 aa AA seqDB search
MKNVLGLRCIDCGKQVPAVAGTYTCPTCGKTGGIMDVEYDYKVINQMTSREQLAQSKDYS
IFRYMPFLPIGPDSARPHLRVGWSPLYKPQGLGKSLGMSNLYVKDDGQNPTASLKDRASI
IAVIKAVEEKAPTVAASSTGNAASSLAGSAAAMGIKSVIFVPSRAPQGKVAQLLIFGATV
ISVQGSYEDTFRLSAEAIERFGWYNRNAAINPYLVEGKKTVALEIAEQLNWEVPDWVILS
VGDGCTIAGVWKGFKDLYNAGWIDRLPKIAGVQSTGCCPLVDAFVENRPWRPKEENTIAD
SIAVGVPRNPDKALNAVRESGGTMVAVSDEEILAAMRELGRTSGIFGEPAGVTGTAGLKV
LVEKGVIGADEKVVSIVTGNGLKDVQNAIKAVGEPIRVEPSLKELLVKLEGKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtgttaggactgcgctgcattgattgcggaaagcaagtcccagcagtggcg
ggaacctatacctgcccgacgtgtggcaaaaccggcggcatcatggatgtggaatacgat
tacaaggtgattaaccaaatgacatcccgtgagcagctagcccagtcgaaggactattcg
atttttcgctacatgccttttctgcccatcgggccggattctgcccgccctcatttgaga
gttggctggagtcctctttataaacctcagggtttgggaaaaagcttaggtatgagtaat
ctttatgtcaaagatgacggtcagaacccgacggcatctcttaaagatcgagcttcgatt
attgctgttattaaagctgtcgaagaaaaggcccccacagttgccgcatcttctaccggt
aatgcagcctcctccttggctggcagtgcggcggctatgggtattaagtccgtaatattt
gtgccaagccgtgcacctcaaggaaaggtagctcaattactgatttttggagctacggtc
atcagtgttcaaggatcttatgaagatacattcagactatccgctgaggcgattgaacga
tttggctggtataaccgcaatgcggctatcaatccctacctggttgaaggtaaaaagaca
gttgccctggaaattgccgaacaattaaactgggaggtgccggattgggttatcctttcc
gttggggatggctgtacaatagcgggggtctggaagggctttaaggatctttataatgca
ggctggattgaccgcttaccgaaaatcgcgggagtgcagtcaactggctgttgtccactg
gtagatgcttttgtggaaaatcgtccttggcgtcccaaggaagagaacaccatcgctgat
agtatcgctgtcggtgtgcctcgtaatccggataaggctttaaatgcagttcgggaatcc
ggtgggacaatggttgctgtgtcagatgaggaaatcctggcagccatgcgagaactgggt
agaaccagcggcatttttggcgagccggcgggagtaacaggaactgccggacttaaggtc
ttggtggaaaaaggcgtgattggcgccgacgaaaaagtagtatcaattgtcaccggtaat
gggttaaaggacgttcaaaacgccattaaagcagttggtgagccgattagggttgagcct
tcccttaaggaactgctggttaagctcgaaggaaaagtctga

DBGET integrated database retrieval system