KEGG   Desulfosporosinus meridiei: Desmer_1482Help
Entry
Desmer_1482       CDS       T02207                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01130  Biosynthesis of antibiotics
dmi01230  Biosynthesis of amino acids
Module
dmi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desmer_1482
Enzymes [BR:dmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desmer_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth PDZ Dioxygenase_N
Motif
Other DBs
NCBI-ProteinID: AFQ43475
JGI: DesmerDRAFT_1482
UniProt: J7IPE0
Position
1555909..1556685
Genome map
AA seq 258 aa AA seqDB search
MILDEIALYTIERVKTLRASKSFEEIREAALAIKSEKPFAFEKGLVNPDIAFICEVKKAS
PSKGIISGSFDYVGIAEEYEKAGANAISVLTEPKFFLGSDKYLTEIKDRVKIPLLRKDFV
IDSYQIYEAKIIGAAAVLLICSLLDTNKLREYIRISDSLGLSALVETHTEAEIKSALQAG
ARIIGINNRNLKTFEVDLQTTISLRHLVPKEVILVSESGIQTIEDIKMLGQSKVNAVLIG
EAFMRSDNKAEVMRELKG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaaattgccctctataccattgaaagagtcaaaacattaagagcaagt
aagtcatttgaggagataagggaagcagccctggctattaagtctgaaaagccttttgcc
tttgaaaaaggactagtcaatccagacattgctttcatttgcgaggtgaaaaaagcctcc
ccgtctaaggggataattagtgggtcctttgattatgtaggtatagctgaggaatatgaa
aaagccggcgcgaacgcaatttctgtactgacagaaccaaaattcttcttgggcagtgat
aaatatttaacagaaattaaagatcgagtgaaaatacctctactccgcaaagattttgtg
attgatagttaccaaatttatgaggcgaaaatcattggtgcggcggcagttctgttaatc
tgcagcttacttgatacgaacaaactacgggaatatatccggatttctgatagtttaggt
ctctcagccctggtagaaacccatactgaagcggagattaagtcagctctgcaagccggt
gccagaattatcggtattaataatcggaacttaaagacatttgaagttgatttgcaaaca
accatctccctccggcatctggtaccgaaagaagtgatacttgtctcggaaagtgggatt
caaacaatagaggatataaaaatgctgggccaaagtaaggtcaatgccgtattgattggc
gaagcatttatgagaagtgataataaggctgaagttatgagggagctaaagggttag

DBGET integrated database retrieval system