KEGG   Desulfosporosinus meridiei: Desmer_1657Help
Entry
Desmer_1657       CDS       T02207                                 

Definition
(GenBank) ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00051  Fructose and mannose metabolism
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Desmer_1657
Enzymes [BR:dmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Desmer_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFQ43632
JGI: DesmerDRAFT_1657
UniProt: J7IP61
Position
1728505..1729155
Genome map
AA seq 216 aa AA seqDB search
MDQQSAARKKVVEKGKEILAANLTIGTWGNISCRISGENCIAITPSGMSYNTLEPEDIVV
LDLNGNIVSGKRKPSVEVPLHLSIYNARQDVEAIIHTHSAYATAMAVARKEIPGAVEDLV
QIAGGNVRVNDYALPGTEQLGINTVKALEGRYAVLLANHGMLGVGRDLDEALKVCQIVEK
SAQIVLLAQMMGGVVELPQEDIDGMRKFYLEVYSQG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaatcggctgcccgaaaaaaagtggtagagaaggggaaagaaatacttgcc
gcaaatcttaccatcggaacttgggggaatattagttgtcgaatttcgggtgagaattgt
atagcaataactccgtcaggaatgagttacaacaccctagagcctgaggatattgtagta
ttagacttgaacggaaatattgtcagtgggaagcgaaagccctctgtagaagtacccttg
catttatcaatttataatgcacgccaggatgttgaggcaataatccatacccacagtgcc
tacgccactgctatggcagtggccagaaaagaaattcccggagcggttgaggatttagtt
cagattgcgggtggtaatgtacgggtcaatgactatgccttaccaggtacggaacagtta
gggattaacacagttaaagcactggaagggcgttatgctgtattgcttgcaaatcacggt
atgctcggtgttggacgtgatttggatgaagctctaaaagtctgtcaaatcgttgaaaaa
tcggcccaaatcgttcttcttgcccagatgatggggggagtggttgaattgccacaagag
gatatcgatgggatgcggaaattttacttagaggtttatagccagggctga

DBGET integrated database retrieval system