KEGG   Desulfosporosinus meridiei: Desmer_1965Help
Entry
Desmer_1965       CDS       T02207                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00010  Glycolysis / Gluconeogenesis
dmi00620  Pyruvate metabolism
dmi00640  Propanoate metabolism
dmi00680  Methane metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01130  Biosynthesis of antibiotics
dmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmer_1965
   00620 Pyruvate metabolism
    Desmer_1965
   00640 Propanoate metabolism
    Desmer_1965
  Energy metabolism
   00680 Methane metabolism
    Desmer_1965
Enzymes [BR:dmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desmer_1965
Lipid biosynthesis proteins [BR:dmi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desmer_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFQ43915
JGI: DesmerDRAFT_1965
UniProt: J7IQM2
Position
complement(2072745..2075066)
Genome map
AA seq 773 aa AA seqDB search
MTEKHNEGLLEEKRFFFPPTEFSAKAIIQNPNIHELGADRATFWNEQGRRLDWFKPWNTV
LEWNPPFAKWYVGGKLNAAYNCLDRHLAGPRRNKAALIFEGELGDRRVLTYQDLYREVSQ
FANVLKSLDVEKGDRVTIYMPLIPETVIAMLACARIGAVHCVVFGGFSAEALKDRIQNSL
SKVVVTTDGSYRRGNSIPLKANVDLALPVTCINNCVESVIVVKRTGQPVDMLEGRDVWYH
EVMKNVSIVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTVGGYMVGVSTTHEWVFDLKEE
DVYWCTADVGWITGHSYLVYGPLSNGATILMYEGAPDFPEKDRYWKIIEDYRVTILYTAP
TAIRTFMKWGESYPLGRDLSSLRLLGSVGEPINPEAWMWYNKFIGGEHCPIVDTWWQTET
GMIMMTPVPGITPLKPGSCTIPFPGVHIEIVDHAGNPVPKGEGGYLVVREPWPAMLKTVY
GDDKRYQDTYWSEIADVYFTGDEAKWDEDGYFWVVGRVDDVINVSGHRIGTAEVEGALVD
HLLVAEAACVGRTHEVKGQAVFAFVSLKEGIEIYDGLIAELKAHVVQKIGALARPDDIFL
TAELPKTRSGKIMRRLLKDIAEGRTIGDTTTLADAEVINFLKKNIDAQKVLDARNASLKF
RRNKVSIPDTAVFNRCSDESYEGYSYTIWFATPAQDGSRHPNTHFYFFQWVERLKLVEQV
ALAITNIMVNNKAAVEAIFAYGTPDFSHAVINEGSITDDLSEEGQICFFGSED
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaacacaatgaaggattgttggaggaaaaacggttctttttccctccaaca
gagtttagtgcgaaagccatcattcaaaaccctaacattcacgaactaggggcggatcgg
gcaacgttttggaatgaacaagggagacggttggactggtttaaaccatggaacacagtt
ctagaatggaatccaccatttgccaagtggtatgtcggcggaaaattgaatgctgcctat
aattgcttagatcgacatttagccggcccgcgtcggaataaagcggccctaatatttgaa
ggagaactgggagatcgcagggtattaacctatcaagatctttatcgtgaggtatcccag
tttgccaacgtgctaaagtctcttgatgtagaaaagggagaccgggtgactatttatatg
cccctgatcccggagactgtgatcgccatgctggcctgtgccagaataggcgctgtgcac
tgtgttgtatttggtgggttcagtgcagaagctttgaaggacaggattcagaactctctg
tcaaaagttgtggtgacaacggatgggagctatcgacgtggaaatagtatccctttgaag
gctaatgttgatcttgccctgcctgtaacttgtatcaacaattgtgtagaaagtgttatc
gtcgtcaagcggaccggtcagcctgtcgatatgttagaaggacgagatgtttggtatcac
gaggtcatgaagaatgtttctatcgtatgtccggcggaaccaatggatgcggaggatatg
ctgtttattctttacacaagtggaacaacgggaaaacccaaaggagttgttcatactgtt
gggggttatatggttggggtatcaacaacccatgaatgggtatttgatctcaaagaggaa
gatgtgtattggtgtactgcggatgtgggctggataacagggcatagttatttggtgtat
gggccattgtcgaatggtgcaacgatcctgatgtatgaaggagccccggattttccagaa
aaggatcgctattggaaaatcatcgaggactatagggtcaccattttatatactgcgccc
actgctattcgcacgtttatgaaatggggggaaagctatcctttaggcagagatctttca
agtttacggctcttgggttcggtgggagaaccgattaacccagaagcttggatgtggtac
aacaagttcatcggaggagagcactgccctatcgtagatacctggtggcaaacggaaacg
gggatgattatgatgacacccgttccagggattactcctctaaagccgggctcttgcacg
atacccttccccggggtccatatagaaatcgtggatcatgccggtaacccggtaccgaag
ggtgagggcggatatttagtggttcgtgagccatggccggcgatgctgaaaaccgtgtat
ggggatgacaaacgctatcaggacacatactggagcgagattgcagatgtgtattttacc
ggggacgaagcgaaatgggatgaagatggttatttctgggtggtcggccgggtagatgat
gtgatcaatgtctcggggcatcggattgggacggcggaagtagaaggtgctttggttgat
catctcttagttgctgaagcagcctgtgtgggcagaacccacgaagttaagggtcaagcg
gttttcgccttcgttagtttaaaagaagggatcgaaatttacgatgggctaattgctgaa
ttaaaagcgcatgtagtccagaaaatcggagcacttgcccgtcctgatgacattttcctg
acggctgaattacctaagacgcgaagcggaaagattatgaggcgtcttctaaaggacatt
gcagagggtcggacaataggcgataccactacccttgccgatgctgaggttattaatttc
ctgaaaaagaatattgatgcccagaaagttcttgatgcgcggaatgcctcgcttaaattt
aggaggaacaaggtttcaattcctgacactgccgtatttaatcgttgtagtgatgagtct
tatgaagggtacagttatacgatatggttcgctacaccagctcaagatggatcacgtcat
ccaaatacccatttttatttctttcagtgggtagaaagactgaagttggtagagcaagtt
gcgttggctatcacaaatataatggtaaacaacaaggctgccgtagaagcaatcttcgcg
tacgggacaccggatttcagccatgcggtgatcaatgaaggcagtattacggatgacttg
tcagaagaaggacaaatttgcttttttggttcagaggactag

DBGET integrated database retrieval system