KEGG   Desulfosporosinus meridiei: Desmer_2082Help
Entry
Desmer_2082       CDS       T02207                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmer_2082
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desmer_2082
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desmer_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2186426..2188177)
Genome map
AA seq 583 aa AA seqDB search
MLYEKTIKVLYIDLAVGKVEVKQRTDLSEYLGGVGIATKLLEETVKPELPPLAPEQPIIL
AIGAISGIYPLVTKTVAMFLSPLTGEMGESYAGGRLALALSMAGYDAVVISGKASRPSYI
AIEGDTVQIKDARPIWGMDSDVVGQFLRDSEEGRGRRSILRIGPAGEKMVKFASVCVDTY
RHFGRLGLGATMGSKLVKAIIISGDNTTKIQNFKDYFRSYQEIFKSVTETDLMSKYHDLG
TAINVESVSALGALPTRNLTENHFDEAEEISGEAFAEKSLVRKMACTGCPVGCIHIGQFR
RKFDEGYDYESVSVAYDYELIYSLGSLLGIPKTDEVLHLIEVVEKTGMDAISAGVALAWA
TESLMHGIVSEEDTIVPLTFGNSENYSKAIRYLASRKNSFYEALGEGTRSAGAKFGGKDH
ALQVAGNEIPGYHTGYANLVGLTVGARHSHLCNAGYSVDQSLKDFDEQKAVNKLFDEELE
RCLLNSLVICLFARKLYNRETVLKALRAAGYPLTDAELTLIAKRIYSTKLRLKEKLGFDP
RQVELPKRFFKTPSMQGILDSTMVERMISQYVEKCEALLAEKI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgttatacgaaaaaaccattaaggttttgtacatagatcttgctgtaggtaaagtcgaa
gtcaagcagcgaacagatttgagcgaatatctcgggggagtcggcatagccacaaaatta
ctcgaagaaaccgttaaacctgaacttcctcctctagcccccgaacaacctattatcttg
gcgattggggcaatatcaggtatctatccattggttactaaaacagttgccatgttcctt
tccccccttacaggagaaatgggagaaagctacgcaggaggcagacttgcattagcatta
tcaatggccggctatgacgctgttgtgatttccggaaaagcgtcccgaccttcttacata
gctattgaaggagatactgtccaaatcaaggatgcccgtcccatttgggggatggactcg
gatgttgtcggacaattcctgcgtgattcagaagaaggccgaggcagacgcagcattttg
cggatcggaccagccggtgaaaagatggtcaagtttgccagcgtatgtgtggatacctat
cggcattttggtcgccttggcttaggggcaaccatgggcagtaaactggtcaaagcgata
attatctccggagataatacgaccaaaattcaaaacttcaaagactatttccgctcttac
caagaaattttcaaatctgtcacagagactgatttaatgtctaaatatcacgacctaggg
acagccatcaatgttgagtcagtaagcgctttaggggctctgcccacgcgaaacttgacc
gaaaatcacttcgacgaagccgaggagattagtggtgaagcctttgccgaaaaaagctta
gtacgaaagatggcctgcaccggctgcccagttggctgcattcatattgggcaattccgt
cgtaagtttgacgagggttatgactacgaatccgttagcgtagcctatgactatgaatta
atctattctcttgggagcctactgggtatccctaaaacggatgaagtattacatctgatc
gaggttgtggaaaaaacaggtatggatgccatctctgccggtgttgccttagcctgggcc
actgaaagcctaatgcacggcattgtctccgaagaggatactattgtccccctaaccttt
ggcaattcggaaaactactctaaggccatccgctatttagccagtcgaaagaattccttt
tatgaagctctcggagaaggaacccgttctgccggtgcaaagttcggcggcaaagaccac
gctctccaagttgcgggcaatgaaatacccggctatcacacgggctatgccaatttagtg
ggtcttaccgtaggtgcacgacactcccatctatgcaatgcaggttactcagttgaccag
tccttaaaagactttgacgaacaaaaagctgtcaataaactctttgacgaggaacttgaa
cgctgtctcttaaattccctcgttatctgtctcttcgctcgaaaattatacaatcgggag
acagtgctaaaagctcttagagcggcaggctatcctttaaccgatgctgagctcacatta
attgccaagcgaatatactccacaaagctgcgccttaaagaaaaactaggcttcgacccg
cgccaagttgagttacctaaacgcttctttaagactccaagcatgcaaggaatcctggat
tcaacaatggtagaacgcatgataagtcagtatgtagaaaaatgcgaagccttactcgcc
gaaaaaatctaa

DBGET integrated database retrieval system