KEGG   Desulfosporosinus meridiei: Desmer_2086Help
Entry
Desmer_2086       CDS       T02207                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dmi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2190001..2190906
Genome map
AA seq 301 aa AA seqDB search
MPEVPEMEIYKNYLNQWVKGKEISELNILRAKSINLELSEFRAKVQGKRIKEIRRRGKYL
IFDFEEGDFLLTHMMLDGRLFLLQLDSETLKKTDSPKAEDLQSVIMGSSAEELKNIVKDL
PGRASVIFGLSGGLILFFCNLTLGYLHYLDQVHLDTKLQELGKDPLDPDFNSRDFSKLLK
GKRGMIKPWLMNPKNISGVGNAYSNEALFSAGILPTRGVSTLDDAEKENLFDSLVRIIRD
SIRLGGDMEEPFAAWDDFTGGYNPYFKVYDRTGKPCLVCGEDIQKSEVGGRNAFFCPHCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagttcctgaaatggagatctataaaaattacttaaatcaatgggtcaaaggg
aaggaaattagtgagctaaatatcttacgagccaaaagcattaacctggagttatcagaa
ttccgcgctaaggtacagggcaagagaattaaagaaattaggcggcggggtaaatattta
atttttgattttgaggaaggcgattttttactgacccatatgatgcttgatggccggcta
tttctcttgcaacttgactccgaaaccctcaaaaagaccgatagcccaaaagcggaagat
ttacagtctgtgatcatggggagcagcgcagaagagttgaagaacatcgttaaggatctt
ccgggaagagccagtgtcatttttggactatccggtggtttgatactctttttttgtaat
ctgaccctgggctatttgcactaccttgatcaagttcatctggatacgaaattgcaggaa
ttaggaaaggatcctttagacccggatttcaacagccgggacttttctaaattgctgaaa
gggaaaaggggaatgatcaaaccttggttgatgaaccctaaaaacatctccggcgtagga
aatgcttattctaatgaagctttattcagtgcaggtatactgccaacccgaggagtttcg
acattagatgatgctgaaaaagagaacctatttgattccttggtcagaattattagagat
tctattcgccttggaggagacatggaggaaccctttgccgcttgggatgactttacaggg
ggatataatccttactttaaagtttatgatcgcacagggaaaccctgcttagtatgtggg
gaggatattcaaaagtcggaagtaggggggcggaatgcctttttttgccctcactgtcag
aagtag

DBGET integrated database retrieval system