KEGG   Desulfosporosinus meridiei: Desmer_2404Help
Entry
Desmer_2404       CDS       T02207                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dmi  Desulfosporosinus meridiei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dmi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dmi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2529754..2530980
Genome map
AA seq 408 aa AA seqDB search
MFVKRVICLLAVLMLVGCQPLQQINNQVQTPAQQADPVKEKPTEKDPIKEQLSKMTLEEK
IGQLVIAGVDGYTKDNHTLELTSKYHVGGFIILGQNVENASQLLTLTNSLKADNKKVSTI
PLFLGIDQEGGKINRMPNQILGTPTNKDIGKINNPGFSEQVGELLGGELKSFGMNLDFAP
VLDINSNSKNPVIGDRSFGNTPQLVSDLGVATMKGIQSEKVISAVKHFPGHGDTSVDSHV
GLPVVNNGLERIEQFELIPFKAAIKQNVGMVMVAHILLPKLDNSYPASMSKYIITDLLRK
QLDFNGVVITDDMTMGAITKNYDIGQAAVRSVNAGADILLVCHDFAKETLVLNTLIAAAK
NGSIHQNTIDESVHRILQLKQNYELADNTVPTVNVQNINDSIKRLFKK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaaaagggttatttgtttattggcagtcctaatgcttgtgggatgccagcct
ttacagcaaattaacaatcaagtacagaccccggcacaacaagcagacccagttaaggaa
aaaccaactgaaaaagaccccattaaagaacaacttagtaaaatgaccttggaagaaaaa
atcggtcaattggtaattgccggggtggatggatacaccaaagataatcacactcttgaa
cttaccagtaaatatcatgttggcggttttattatactggggcagaacgtagagaacgcc
agtcaattgttaaccctaaccaattccttaaaggcagacaataagaaagtatctacgata
ccgctgtttctgggaattgaccaagagggcggcaaaatcaacaggatgcccaatcaaatt
ctcggtactcccaccaataaagatatcggcaagataaataatccaggcttttctgagcag
gtaggtgaactactgggaggagaattgaaatcctttgggatgaacctagactttgcgccg
gtcttagatattaacagcaattctaagaacccggttattggtgaccgctcttttgggaat
acccctcaattggttagtgatctgggcgtagcaaccatgaagggaattcaatccgaaaaa
gtgatctctgcagtaaaacattttccggggcacggagacacttcggtcgattcccatgtg
ggattaccggtagtgaataatggattagaacgaattgaacagttcgaattgattcccttt
aaagccgccattaaacaaaatgtaggtatggtgatggtcgcccatatattacttccgaaa
ctggataactcatatccggccagtatgtctaaatatataatcaccgacctgctaagaaag
caactagactttaacggtgtggttattacggatgacatgaccatgggagcaattactaag
aattacgatattgggcaagctgcggttcgttcagtgaatgcaggtgcagatatcctattg
gtctgccatgatttcgccaaggaaaccctcgtgcttaacaccttgattgctgcagcgaaa
aacggaagtattcaccaaaataccatagatgaaagcgtgcatagaatccttcagctaaaa
cagaactatgagctggcggacaacactgtaccaactgtaaatgtacagaacatcaatgat
tcaattaaaaggttatttaaaaagtga

DBGET integrated database retrieval system