KEGG   Desulfosporosinus meridiei: Desmer_2622Help
Entry
Desmer_2622       CDS       T02207                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmer_2622
   01230 Biosynthesis of amino acids
    Desmer_2622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmer_2622
   00030 Pentose phosphate pathway
    Desmer_2622
   00051 Fructose and mannose metabolism
    Desmer_2622
   00052 Galactose metabolism
    Desmer_2622
  Energy metabolism
   00680 Methane metabolism
    Desmer_2622
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desmer_2622
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desmer_2622
Protein phosphatases and associated proteins [BR:dmi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desmer_2622
Messenger RNA biogenesis [BR:dmi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desmer_2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2763675..2764643)
Genome map
AA seq 322 aa AA seqDB search
MSRDIKRIGVLTSGGDAPGMNAALRAVVRKGIFHGLRVYGISRGYEGLIHGELTEMSLGS
VADIVLRGGTILKTARSAEMMTPEGQQKALEQLHKHEIDALVVIGGDGSFRGAQTLAKGI
QIVGIPGTIDNDIPGTDLTIGFDTAVNTVIDAVGKIRDTATSHERTFVVEVMGRHCGNIA
LQAGIACGAESILVPEIPFDFDEICEKLKRGHQRGKNHSIIIVSEGAGSAYKIGEELHSR
SGFDTRITILGHLQRGGNPSALDAVIAAAMGGKAVEIIMSKETNKMTAYVNQNVVSIPLD
VAYGEMPPFNRELYDLANQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagatattaaacgtataggggtactaacgagtggaggggatgctcctggtatg
aatgctgcccttcgggccgttgtcagaaaagggatttttcatggtctaagggtgtatgga
attagtcgagggtacgaagggttaatccatggagaactcacagaaatgagcttaggttct
gtagcagatattgttctgcgcggcggaaccatcctgaaaacagctcgctcggcagaaatg
atgactcctgaaggccaacaaaaggccttagagcagttacataagcatgaaattgatgct
ttagtggtcattggtggagatggttcgtttagaggagcccaaaccttggcgaaaggaatt
caaatagttggtatacctggaactatcgacaatgacatcccggggacagatctaaccata
ggttttgatacggcagttaatacagttatcgatgctgttggtaaaattagagataccgcg
acctcccatgaaaggacgtttgttgttgaagttatgggcaggcactgtggaaatattgct
cttcaggcaggaatagcttgtggtgctgagtcaattttagtacctgaaataccctttgat
ttcgatgagatatgtgaaaagttgaaacggggtcatcagcgtgggaaaaatcacagtatt
atcattgtttctgagggggcaggaagcgcctataaaattggcgaggaattacactctcgt
tcaggctttgatactaggattactattttgggacatcttcaacgtggcggcaacccaagt
gctttagatgctgtgattgcagcagccatgggaggaaaagctgttgaaattattatgtct
aaggagaccaataaaatgactgcatatgtcaatcagaatgtggtttctatccctctcgat
gttgcctacggcgagatgccaccctttaacagagaactttatgatttagcaaatcagctt
tcaatttag

DBGET integrated database retrieval system