KEGG   Desulfosporosinus meridiei: Desmer_2790Help
Entry
Desmer_2790       CDS       T02207                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desmer_2790
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desmer_2790
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desmer_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2923588..2924709)
Genome map
AA seq 373 aa AA seqDB search
MKISEVRRVVLKIGSSSLNHPQGGIDERAINEIASVIAALKQSGVECIIVSSGAVAAGMG
QLKLSARPRDLAGKQAVAAVGQGVLIEMYTRYLERQGIIGAQVLLSRIDLAQASHYRNAQ
NTLEKLLRLQVVPIINENDTVAVDELCFGDNDTLSALVAGLVGADLLVILTDVDGLYSAN
PKKDQSAQLIKEVTDVSAVECMASGAGSLLGTGGMVTKLRAAKIATRFGIGMLLLNFTRL
PELSPSTKSQEPLGTFFQPLKHRLAGRKRWIAYAGLSEGSIQVDEGAAKALVEEGKSLLA
KGITNVEGTWERKEIVRIINSQREEIARGVVELSDAEVKLVKGLHSEKLHQFVESFDGEE
VVHRDNMTLMVDA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcagtgaggttcgcagggttgttttaaaaatagggagcagcagcttaaaccat
ccacaaggtgggattgatgagcgtgcaattaatgagattgcttcagtcattgccgcttta
aaacagagtggcgttgagtgcataatcgtttcatctggtgcagtagctgccgggatggga
caactaaagctttcagctcgtccacgtgatttagcaggcaaacaagctgtagcagctgta
ggtcaaggagtcctcattgagatgtatacccgttatcttgaacgccaaggaattattggg
gctcaggtattactttcccgtattgatttggcacaagcctctcactatagaaacgcccaa
aacactttagagaaattactgcgtttacaagttgtgcccatcattaatgaaaacgacaca
gttgcggtagatgaactttgctttggagataatgacactttatctgccttagttgccgga
ctcgttggggcagatttattggtcattttaacggatgtcgatggcttgtactctgcaaat
cccaaaaaggatcaatccgctcaactaattaaagaggtcaccgacgtttcagccgttgaa
tgtatggcgagtggggcaggaagcttattaggaactggagggatggttactaaacttagg
gccgccaagatagctacacgttttggaattggaatgctgcttttaaactttacaagattg
ccggaacttagcccgtcaactaaaagccaagaacctttgggaacattttttcaaccgctc
aaacatcgactggcaggtcgtaaacgttggattgcctatgcaggattatctgaaggcagt
attcaagttgatgaaggcgcggccaaagcccttgtggaagaaggaaaaagtttgctggct
aaaggaattaccaatgttgaaggaacttgggaacgaaaagaaatcgttcgaataattaat
tcccagagagaagaaattgctagaggcgttgtcgagctaagcgatgctgaggtaaagctg
gtaaagggtttgcactctgagaaattacatcaatttgttgagagctttgatggtgaagaa
gtagttcaccgggacaatatgacacttatggttgatgcctaa

DBGET integrated database retrieval system