KEGG   Desulfosporosinus meridiei: Desmer_3589Help
Entry
Desmer_3589       CDS       T02207                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dmi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3731447..3732499)
Genome map
AA seq 350 aa AA seqDB search
MLLKSLSELNGTSGAENLVRNFLRQTIEPFVDIISTDKMGNLIGMKNDSLSGPKVMLAAH
MDEVALMIIDITGEGFLKFRPVGGIDARILVSKPVQINNSCVGVIGAKAIHLQKHTERQN
ALSCDQLYIDIGAKSKEDASSKVKLGDYAYFTTEFEPFGDGLYKGKALDGRVGCAILAEL
LKNDYDFPLIAGFTVQEEVGLRGAKVAAHHLAPDFAIILEASVADDMSEGAEDGWITELG
NGPACSLMDRSTLYSAKLIQWVTSVARQNGIPLQFRRGSGGGNDAGSIHISNVGIPTICL
NVPCRYIHSFASVISEKDYRDCYDLVNALLKELPNFFEGSSINFAKEDKS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaagagtcttagcgaattaaatggtacttcaggggcggaaaatcttgttcgt
aatttcttgcggcaaacaatagaaccctttgtagacattattagtactgacaaaatggga
aatctgattgggatgaaaaatgactctctttccggcccaaaagtaatgctggctgcccat
atggacgaagtggccttaatgattatcgatataaccggagaaggatttcttaaatttcgc
cctgttggcggaatagatgcccgaattctggtctcaaaacctgttcaaatcaacaactcc
tgcgtgggagttattggggcgaaggccattcatctccaaaaacatacggaacggcaaaat
gctttgtcctgtgaccaactttatattgatatcggagcaaaatccaaagaagatgcttca
agcaaagtaaaacttggagattatgcctatttcacaaccgaatttgagccctttggagac
gggctttataagggtaaggcccttgatggccgagtgggatgtgccatattagcagagctg
ctcaaaaacgattatgatttccccttgattgcagggtttactgttcaagaggaggtaggc
ctgcgaggggctaaggttgccgctcatcacttggctccggattttgcaatcatactggaa
gcaagtgtggcggacgatatgtccgaaggtgccgaagatggttggatcaccgagctcggt
aatggtcccgcttgttcattaatggatagatcgacactctatagtgccaagctcatccaa
tgggtgacgagtgtagctcgacaaaacggtattcctttacagtttcggcgcggaagtggt
ggcggaaacgatgccggttcgatacatatcagcaatgttggaatacccaccatttgtttg
aatgtgccgtgtcgctatatccattcttttgcctcagtaatttcagaaaaggattataga
gattgttatgaccttgttaatgctcttctaaaggaattaccaaatttctttgaaggaagc
tcaattaattttgctaaggaggataaatcttaa

DBGET integrated database retrieval system