KEGG   Desulfosporosinus meridiei: Desmer_3684Help
Entry
Desmer_3684       CDS       T02207                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00900  Terpenoid backbone biosynthesis
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desmer_3684
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Desmer_3684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C NAD_binding_3 PrpR_N DUF1418 YhfT
Motif
Other DBs
NCBI-ProteinID: AFQ45520
JGI: DesmerDRAFT_3684
UniProt: J7IUW1
Position
complement(3838956..3840104)
Genome map
AA seq 382 aa AA seqDB search
MKTLTILGSTGSIGRQTLDVVSHAEGRLKIYALAADKNVRLMEEQARLFQPEVVVMMDEP
AASDLRGRLRDLPIKVAQGMEGIINSVVAEKVDIVVTALSGRVGLEPTLSAIAAGKTIAL
ANKETLVAGGDLVMSAAEKNGCKILPVDSEHSAIFQCLEESPETIEKIILTASGGPFFGW
TKEKLDTVTLEKALCHPNWEMGAKITIDSSTMMNKGLEVIEAHHLFALEYDAIEVLIHPQ
SVIHSMVEYQDGSVLAQLGRPDMRLPIQYALSYPTRWKNPFERLNLRGKTLTFHEPDFEA
FPALALAYQVGRRGGTLPAVMNAANEVVVLAFLQKKVSYPAIINIVKKVCSEHYVLDNLD
LGSILDADNWARQRAEELISGF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacactgacaatcttagggtctacagggtcgatagggcggcaaacattagatgtt
gtcagtcatgccgaaggacgccttaaaatttacgccttggcagccgataaaaatgtccgg
cttatggaagaacaggctcggctgtttcaacctgaagttgtagtaatgatggatgaacct
gctgccagtgatctacgcggtcggttgagagatttaccaatcaaagtggctcaaggaatg
gaaggaataattaattctgttgttgctgagaaagtcgatatagttgttaccgccctatca
ggcagagtagggttggaacctacgctatctgcaattgcagcaggaaaaactattgccctt
gccaataaagagaccttagtggccggcggagatttggtaatgtccgcggctgaaaaaaac
ggctgtaaaatactacctgtggacagtgagcattcagccatatttcagtgtttagaagaa
agtcctgaaacaatcgaaaaaattattttgacggcttcgggaggtcctttctttgggtgg
acaaaggaaaagttagacactgttactttggagaaagcactttgccatccaaactgggaa
atgggtgcaaaaattactattgattcttcaacaatgatgaataaaggattggaagtcatt
gaggcccatcatttgtttgccttggagtatgatgcaatagaagttctcattcatccacag
agtgtaatccactctatggtcgaatatcaggatggttccgtactagctcagttaggcagg
ccggatatgcgattgccaattcaatatgctttaagttacccaacacgatggaaaaatccc
tttgagcgacttaatcttcgggggaaaaccttgacattccatgagccggattttgaagcc
tttccggccctggctttagcgtatcaagttggtcgacgagggggaactctcccagctgta
atgaatgcggctaatgaggttgtagttttagcatttctccaaaagaaggtttcttatccg
gcaattataaatatcgttaaaaaagtctgctcggaacattatgttttagataatctggat
ctgggaagtatactcgatgcagataattgggctcgtcaacgggccgaagaattaatttct
gggttctaa

DBGET integrated database retrieval system