KEGG   Desulfosporosinus meridiei: Desmer_3792Help
Entry
Desmer_3792       CDS       T02207                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00230  Purine metabolism
dmi01100  Metabolic pathways
Module
dmi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desmer_3792
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desmer_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 AAA_22 ADK RNA_helicase TsaE AAA_17 Zeta_toxin AAA_5 RsgA_GTPase ABC_tran PduV-EutP Thymidylate_kin APS_kinase NTPase_1 Cytidylate_kin cobW T2SSE Mg_chelatase MobB AAA_29 Rad17 AAA ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: AFQ45628
JGI: DesmerDRAFT_3792
UniProt: J7J2U9
Position
complement(3946292..3946930)
Genome map
AA seq 212 aa AA seqDB search
MSKTRRIRGGVVEQSHGLLIILSGPSGAGKGTLCQELLRQLPDLKYSVSMTTRNSRPGEI
DGIHYFFRQKEEFEALIERDELLEWAQFCDNYYGTPRFAVEQAIQAGQDVILEIEIQGAL
QVKKRFPQGVFTFIVPPSMDALSERIHKRGTESEEVIQKRLATAIHELEYVSEYDYVVVN
DEVPEAVDKLKSILVAEKCRVKRKPFVFEGGI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacccgtcggattaggggtggagtagtggaacaaagtcatggattattaatt
atcctttctgggccttcaggggcaggaaagggaaccctttgccaagaattgctccgtcag
ctcccagacctaaagtattctgtctctatgactacacgtaattcgcgtcctggtgaaatt
gatggaatccattatttctttcgtcagaaggaagaatttgaagctctgattgaaagagat
gagctgttggaatgggcccagttttgtgataattactacggaacaccgcgttttgcagtt
gaacaagcaatccaagcagggcaggatgttattttggaaattgagatccaaggagcatta
caagttaagaagcgttttcctcaaggggtttttacatttattgttccaccgtcaatggat
gctctttctgagagaattcacaaacggggaactgagagtgaggaagttattcaaaagcgc
ttagccacagccatacatgaacttgagtatgtgagtgaatatgattatgttgtcgttaat
gatgaagttcccgaagctgttgataaattgaaaagtattttggttgctgaaaaatgccgg
gtaaaacgaaaaccctttgtttttgaaggaggaatttaa

DBGET integrated database retrieval system