KEGG   Desulfosporosinus meridiei: Desmer_3814Help
Entry
Desmer_3814       CDS       T02207                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desmer_3814
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desmer_3814
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desmer_3814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3973433..3974368)
Genome map
AA seq 311 aa AA seqDB search
MKWQRKDILAIEDMSVEEIRHILHTAKVMKEILMRPIKKLPTLKGKSVVNLFYEASTRTR
TSFEMAAKVLGADTTSIAVAQSSVSKGESLYDTAKTIQAMRADVVILRHPSSGSAKFLAD
ILDPAVINAGDGQHAHPTQALLDIFTMQEHLGELEGKNVVIVGDVLHSRVARSNAWCLQK
MGVNVTLAGPPTLVPAEMEGLGVNMTHDLDSALPGADIVMALRLQLERQKSGLFPSLREY
SHLYGLTTERLKKTGKQSIVLHPGPMNRGVEISDDVANGVDALIERQVTNGVAIRMALIY
LLIGGSGNVVA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggcagcgtaaagatattctagcgattgaggatatgagtgtggaggaaatccgt
catattttgcatactgcaaaagtgatgaaagagattttaatgcgtccaataaaaaaattg
cctacattaaaaggaaaatcagtagttaatcttttctatgaagcaagtacaaggactcga
acctcctttgaaatggctgcgaaggttttaggggctgatacaacaagtattgcagttgct
cagagcagtgtaagtaaaggagagagcttatatgatacagcaaagacgattcaggcaatg
agagctgatgtcgtgatactgaggcatcctagttcaggttcagcgaagtttttagcagat
atcttagacccggcagtcattaatgcaggtgatgggcagcatgcccacccaacccaagca
ttactggatatatttacgatgcaggaacatttgggagagctagaaggtaagaacgtggtc
attgtgggggatgttttacattctagggttgctagaagtaatgcttggtgtctgcaaaag
atgggggtaaatgtgactttggccggacctccgacgcttgttcccgctgaaatggaagga
ttgggagttaacatgactcatgatctagacagtgctttacccggagcggatatcgttatg
gcccttcgcctccaacttgaaagacagaaaagcggactctttcccagtctccgtgaatat
agccacctgtatggcttgaccacagagcgtctcaagaaaacaggcaaacaaagcatcgtg
ttgcaccccggcccgatgaatagaggggttgaaatttccgatgatgttgctaatggggtc
gacgccttgattgagcgtcaagtcacgaatggtgtagcaatccgtatggcattgatttat
ttactgataggagggtccggcaatgtggtggcttaa

DBGET integrated database retrieval system