KEGG   Desulfosporosinus meridiei: Desmer_3814Help
Entry
Desmer_3814       CDS       T02207                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00240  Pyrimidine metabolism
dmi00250  Alanine, aspartate and glutamate metabolism
dmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desmer_3814
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desmer_3814
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desmer_3814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFQ45650
JGI: DesmerDRAFT_3814
UniProt: J7IV91
Position
complement(3973433..3974368)
Genome map
AA seq 311 aa AA seqDB search
MKWQRKDILAIEDMSVEEIRHILHTAKVMKEILMRPIKKLPTLKGKSVVNLFYEASTRTR
TSFEMAAKVLGADTTSIAVAQSSVSKGESLYDTAKTIQAMRADVVILRHPSSGSAKFLAD
ILDPAVINAGDGQHAHPTQALLDIFTMQEHLGELEGKNVVIVGDVLHSRVARSNAWCLQK
MGVNVTLAGPPTLVPAEMEGLGVNMTHDLDSALPGADIVMALRLQLERQKSGLFPSLREY
SHLYGLTTERLKKTGKQSIVLHPGPMNRGVEISDDVANGVDALIERQVTNGVAIRMALIY
LLIGGSGNVVA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggcagcgtaaagatattctagcgattgaggatatgagtgtggaggaaatccgt
catattttgcatactgcaaaagtgatgaaagagattttaatgcgtccaataaaaaaattg
cctacattaaaaggaaaatcagtagttaatcttttctatgaagcaagtacaaggactcga
acctcctttgaaatggctgcgaaggttttaggggctgatacaacaagtattgcagttgct
cagagcagtgtaagtaaaggagagagcttatatgatacagcaaagacgattcaggcaatg
agagctgatgtcgtgatactgaggcatcctagttcaggttcagcgaagtttttagcagat
atcttagacccggcagtcattaatgcaggtgatgggcagcatgcccacccaacccaagca
ttactggatatatttacgatgcaggaacatttgggagagctagaaggtaagaacgtggtc
attgtgggggatgttttacattctagggttgctagaagtaatgcttggtgtctgcaaaag
atgggggtaaatgtgactttggccggacctccgacgcttgttcccgctgaaatggaagga
ttgggagttaacatgactcatgatctagacagtgctttacccggagcggatatcgttatg
gcccttcgcctccaacttgaaagacagaaaagcggactctttcccagtctccgtgaatat
agccacctgtatggcttgaccacagagcgtctcaagaaaacaggcaaacaaagcatcgtg
ttgcaccccggcccgatgaatagaggggttgaaatttccgatgatgttgctaatggggtc
gacgccttgattgagcgtcaagtcacgaatggtgtagcaatccgtatggcattgatttat
ttactgataggagggtccggcaatgtggtggcttaa

DBGET integrated database retrieval system