KEGG   Desulfosporosinus meridiei: Desmer_3854Help
Entry
Desmer_3854       CDS       T02207                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dmi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dmi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4013545..4015023)
Genome map
AA seq 492 aa AA seqDB search
MPRANKSLLDIFSGIEILESLGDCGVIVRGMSMDSRHVQSGDLYACVPGLQVDGHDFAAG
AVASGAVALVVERFLPLDVPQIRVLSVRQVMGALAAIIYDHPSEQLELVGVTGTNGKTTI
TYLIEKIGIKLGKKVGLIGTLGARINGRAIPGERTTPEAIEVQKLLAEMVAEDVNLAVME
VSSHALVLGRVAGCEFDAGIFTNLTQDHLDYHKTMEDYLAAKSLLFSNLKGTKQLKKISI
LNGDDPVFKELSQASIASVVSYGINNKVDYRAENVEVTPEGVRFQVQFKGVVQDVWYATP
GYFSVYNALAAFVWGVERGYPPATVAEALSEIAGVPGRFESVRQGQPFQVIVDYAHTPDG
LENVVRTAKSFTKGRLFTVFGCGGDRDRTKRPLMGEVASKGSDFLIVTSDNPRTEDPDQI
IQEILTGVSGVEHVALADRREAIWSACRQAKTGDTILIAGKGHETYQIFGKEVHPFDDRE
VAREALRGLGYA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcctagagcgaataaatcgttattagacatattcagtggtatagagattctggaatcg
ttaggggattgtggagtcatcgtccgcggaatgtcaatggattcgaggcacgtgcagtca
ggggatttatatgcttgtgtaccaggccttcaggtagatggtcatgattttgcggctggt
gcagttgcctccggggctgtggctttagttgtggaaaggtttttaccactggatgtcccc
cagattcgagttttaagtgtgcgtcaagttatgggagcgctggcagctataatctatgat
catccgagtgagcagcttgagctagtcggtgtaaccggcacaaacggcaaaactaccatt
acttatcttattgagaaaatcgggataaagcttggcaagaaagttggcttgataggaaca
ttaggtgctcgaataaatgggcgggctattcccggggagagaacaactcctgaggctata
gaggttcagaagcttttggcggaaatggttgctgaagatgtgaacttggctgtaatggaa
gtatcatctcacgctttggtattaggacgggtggccgggtgtgaatttgatgcaggaatt
tttacaaatttgacacaagatcatctggattatcataaaacaatggaggactatctggcg
gcgaaatctctcctgttttccaatctgaaagggactaagcaactaaagaagattagtatt
ctaaacggggatgatccggtatttaaggaattaagccaagcttcaattgcttcagttgtg
agttatggaatcaataataaggttgattatcgggcagagaatgtagaagtaaccccggaa
ggggtacgcttccaggttcaatttaagggagtagtacaagatgtttggtatgcaaccccc
ggatattttagtgtttacaatgctttagcagcctttgtctggggagtagagcggggctat
cccccagcaactgttgctgaggccctttccgaaatagccggagttcccggtcgctttgaa
agcgttcgtcaaggtcagccgtttcaggttatcgtggattatgcccatacccccgatggc
ttggagaatgtagtaagaaccgctaagagctttaccaaaggtagactttttaccgtcttc
ggttgcggaggggatcgcgataggacaaaacgccctttgatgggagaggttgcttcaaag
gggagtgactttttgattgtaacttcagataatccccgaacggaagatccggatcaaatt
atccaagagattctgaccggtgtttcaggagtggagcatgttgctctagcagaccgtcgg
gaagcaatttggagtgcctgtcgtcaagcaaagacgggtgatacaattttgattgccggt
aaagggcatgaaacctatcagatctttggcaaagaggttcatccctttgatgaccgtgag
gtagcacgtgaagcattaagggggctcggctatgcgtaa

DBGET integrated database retrieval system