KEGG   Desulfosporosinus meridiei: Desmer_3920Help
Entry
Desmer_3920       CDS       T02207                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desmer_3920
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desmer_3920
Enzymes [BR:dmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desmer_3920
Two-component system [BR:dmi02022]
 CheA family
  CheA-CheYBV
   Desmer_3920
Bacterial motility proteins [BR:dmi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desmer_3920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4079999..4081201)
Genome map
AA seq 400 aa AA seqDB search
MMSAPRQIGVLIVDDSPFMRLTLQKILSQDPSIKVLDTAKDGREGILKLQSLRPDVITMD
VEMPVMNGLQALDEIMRWQPTSVIILSAVTTEGAESTLKAFDLGAVDVVAKPSGKPGADL
QVLSRDLVEKVKAAALVNLARLRPNKGIASSQQNPSTAALSASTSATVQPGITKITPSKS
PSSPSGVSSGNASRTFSGGKSGVLPKHPVEIVAIGTSTGGPSALQAVLPVLPKNFPVPVL
VAQHMPPGFTGPLAQRLNGLCELNVREGVNGEVLKAGTVYVAPAGKQLQVQRRSGQLTLN
IGDDAPIPTLYHPSIDVMFLSLGKEVGKGTLGVVMTGMGSDGTKGMKELKKLEGFAIAEA
EETCVVYGMPRSVVEAGLADRVVPLSEIGKAIVECVMRRG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagcgcctaggcaaatcggggttctgatcgtcgatgattcaccttttatgaga
ttaactctgcaaaaaattctcagtcaagatccctccattaaagttttggatactgcaaag
gatgggcgtgaggggatacttaagcttcaatctcttcgtccggatgtaataactatggat
gtggagatgcctgtcatgaatgggcttcaggccttagacgaaattatgcgctggcaaccg
acttcagtaatcatcttgagtgctgtgacaacggaaggggcagagtctaccttgaaggct
tttgatctaggtgcagtagatgttgtagctaaaccatcgggaaaaccgggcgcggatttg
caggttttatctcgtgatttagtagaaaaggttaaggctgcggctttggtcaatcttgcg
cgcctaagacctaataagggtatagcttcttctcaacagaacccctctacagcagcactc
tctgcaagtacttcagcaactgttcagcctggcattacgaagattacaccatccaagtca
ccctcatcgccttcgggtgtaagctcaggaaatgcttctcggacattttctgggggtaag
agtggagtgctgcctaaacatcctgtggaaattgtagccattggcacttcaacaggtggc
ccctcggctctacaagcggtattgcccgtgcttccgaaaaattttccggttcctgtatta
gtagcccaacatatgcctcccggttttacaggccctctggctcaacgcttaaatgggttg
tgtgagctaaatgtacgagaaggagtcaatggtgaggtattaaaagcgggaacagtgtat
gtggctccggcagggaaacaacttcaagttcagcgccgatccggtcagttgacccttaat
attggggatgatgccccaatccccactctttatcatccttccattgatgtgatgttcctt
tccttaggaaaggaagttgggaaagggactctgggagtggttatgaccggtatgggaagt
gatggtactaaggggatgaaagagcttaagaaactcgaggggtttgccattgccgaggct
gaagaaacctgtgtagtctatgggatgcccaggtctgtagtggaagccgggcttgccgac
cgggttgtgccccttagcgagattggaaaagccattgtggaatgtgttatgaggagggga
taa

DBGET integrated database retrieval system