KEGG   Desulfosporosinus meridiei: Desmer_4344Help
Entry
Desmer_4344       CDS       T02207                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desmer_4344
   00052 Galactose metabolism
    Desmer_4344
   00500 Starch and sucrose metabolism
    Desmer_4344
   00520 Amino sugar and nucleotide sugar metabolism
    Desmer_4344
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desmer_4344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4551258..4552145)
Genome map
AA seq 295 aa AA seqDB search
MRRIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQHIVEEAIQSGIEDIIIVTGRN
KRAIEDHFDRSMELEGFLEKNSKDELLDLVQDIARMADIYYVRQKEALGLGHAIYSARKF
IGNEPFAVLLGDDVIYSEVPALKQMINHYQRYGASIVGVQEVPYEDTIKYGIVDGEKFAD
RLYRAKNMVEKPRPEEAPETRLAIMGRYILNPEIFNILEELPAGRGGEVQLTDGIKELGR
FQEILAYEFEGRRYDVGDKLGFVEATIDYALRRGDLSEDLINYLRDIVRKADKSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaattcgtaaagcagtcataccggcagctgggttgggaactcgatttttaccg
gccactaaagcccaaccgaaagagatgctgccgattgtggataaaccaaccattcagcac
attgtagaagaagctatccaatccggtatagaggacattattatcgtaacaggacgaaac
aaacgtgctatagaagatcactttgaccgttctatggaacttgaagggtttttggaaaaa
aactctaaagatgagctcttagaccttgttcaggatattgctcgaatggctgatatctat
tacgttcggcaaaaggaagccttaggcttaggtcacgcaatctatagtgcccggaaattt
ataggtaatgagccttttgcggttctcttaggtgatgatgtaatttactcagaagtaccg
gcgttaaagcaaatgattaatcattaccagcgctacggagcaagtattgtcggggtacaa
gaggttccctatgaggacacaatcaaatacgggatagtcgatggagaaaaattcgccgat
cgactttacagagctaagaacatggtggagaaaccccgtccggaagaagcaccggaaact
cgtttagccatcatgggacgttacatcttaaacccggagatattcaatattctagaggaa
ttaccggcaggcaggggcggagaagtacagctgacagacggtattaaagaactgggtcga
tttcaggaaatactcgcttatgaatttgagggtcgcagatatgatgttggagacaaactg
gggtttgtggaagcaaccattgattatgccttacggagaggagatctttctgaggatctg
attaattatctgcgggacattgttaggaaagccgataaaagtagttaa

DBGET integrated database retrieval system