KEGG   Desulfosporosinus meridiei: Desmer_4344Help
Entry
Desmer_4344       CDS       T02207                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desmer_4344
   00052 Galactose metabolism
    Desmer_4344
   00500 Starch and sucrose metabolism
    Desmer_4344
   00520 Amino sugar and nucleotide sugar metabolism
    Desmer_4344
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desmer_4344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4551258..4552145)
Genome map
AA seq 295 aa AA seqDB search
MRRIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQHIVEEAIQSGIEDIIIVTGRN
KRAIEDHFDRSMELEGFLEKNSKDELLDLVQDIARMADIYYVRQKEALGLGHAIYSARKF
IGNEPFAVLLGDDVIYSEVPALKQMINHYQRYGASIVGVQEVPYEDTIKYGIVDGEKFAD
RLYRAKNMVEKPRPEEAPETRLAIMGRYILNPEIFNILEELPAGRGGEVQLTDGIKELGR
FQEILAYEFEGRRYDVGDKLGFVEATIDYALRRGDLSEDLINYLRDIVRKADKSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaattcgtaaagcagtcataccggcagctgggttgggaactcgatttttaccg
gccactaaagcccaaccgaaagagatgctgccgattgtggataaaccaaccattcagcac
attgtagaagaagctatccaatccggtatagaggacattattatcgtaacaggacgaaac
aaacgtgctatagaagatcactttgaccgttctatggaacttgaagggtttttggaaaaa
aactctaaagatgagctcttagaccttgttcaggatattgctcgaatggctgatatctat
tacgttcggcaaaaggaagccttaggcttaggtcacgcaatctatagtgcccggaaattt
ataggtaatgagccttttgcggttctcttaggtgatgatgtaatttactcagaagtaccg
gcgttaaagcaaatgattaatcattaccagcgctacggagcaagtattgtcggggtacaa
gaggttccctatgaggacacaatcaaatacgggatagtcgatggagaaaaattcgccgat
cgactttacagagctaagaacatggtggagaaaccccgtccggaagaagcaccggaaact
cgtttagccatcatgggacgttacatcttaaacccggagatattcaatattctagaggaa
ttaccggcaggcaggggcggagaagtacagctgacagacggtattaaagaactgggtcga
tttcaggaaatactcgcttatgaatttgagggtcgcagatatgatgttggagacaaactg
gggtttgtggaagcaaccattgattatgccttacggagaggagatctttctgaggatctg
attaattatctgcgggacattgttaggaaagccgataaaagtagttaa

DBGET integrated database retrieval system