KEGG   Desulfosporosinus meridiei: Desmer_4498Help
Entry
Desmer_4498       CDS       T02207                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00010  Glycolysis / Gluconeogenesis
dmi00051  Fructose and mannose metabolism
dmi00562  Inositol phosphate metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01130  Biosynthesis of antibiotics
dmi01200  Carbon metabolism
dmi01230  Biosynthesis of amino acids
Module
dmi_M00002  Glycolysis, core module involving three-carbon compounds
dmi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmer_4498
   00051 Fructose and mannose metabolism
    Desmer_4498
   00562 Inositol phosphate metabolism
    Desmer_4498
Enzymes [BR:dmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desmer_4498
Exosome [BR:dmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desmer_4498
  Exosomal proteins of bladder cancer cells
   Desmer_4498
  Exosomal proteins of melanoma cells
   Desmer_4498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: AFQ46303
UniProt: J7J4X9
Position
complement(4703011..4703775)
Genome map
AA seq 254 aa AA seqDB search
MANRRKVIAGNWKMFKTVSEAEDYAIKFLEEVKDVTDLDVVLCAPFTALHALKNELEESI
VHLGAQNMAWAEEGAYTGEISARMLLDVACTYVILGHSERREMFGETDQDIAKKVQQALA
VGLTPIFCCGENLKLREEGKAAEWVKNQVASALSGISKDDLLRIIVAYEPIWAIGTGKTA
SSQDAQEMCANIRATLTELMGSASENVPILYGGSVKAENIGELMQEPDVDGALVGGASLD
PLSFAKLIKNASPM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggctaatcgacgaaaggttatcgccggaaactggaaaatgtttaaaactgtcagtgaa
gccgaggactatgccataaagtttttagaggaagtcaaggatgttacagacctagatgtt
gtcctctgtgctccgtttacggctctccatgctctaaaaaatgagttggaagaaagcatt
gtccatctgggtgcgcagaatatggcttgggcggaagagggcgcctataccggagagata
tcagcacgtatgctgcttgatgtcgcctgtacatacgtaatactcggtcactctgaacgc
cgggagatgtttggagaaacagatcaggacattgctaagaaagttcagcaggcattggcg
gtagggttaactcctatcttttgttgcggggaaaatttgaaacttcgtgaagaggggaag
gcagccgagtgggtcaaaaaccaagttgccagcgctctttccggaatatccaaagatgat
ctgttgaggataattgtggcctatgagcctatttgggcgattggcaccggtaagaccgca
tccagtcaagatgctcaagagatgtgtgctaatatccgtgcgactttgacggagctgatg
ggatcggcctctgagaatgttcctatactctatggaggcagtgtcaaagctgaaaatatt
ggggaactaatgcaggagcctgatgtagatggggctttagtcggtggggcaagtcttgat
ccccttagttttgcgaaacttatcaaaaatgcaagtccaatgtag

DBGET integrated database retrieval system