KEGG   Desulfosporosinus meridiei: Desmer_4498Help
Entry
Desmer_4498       CDS       T02207                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmi  Desulfosporosinus meridiei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmer_4498
   01230 Biosynthesis of amino acids
    Desmer_4498
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmer_4498
   00051 Fructose and mannose metabolism
    Desmer_4498
   00562 Inositol phosphate metabolism
    Desmer_4498
Enzymes [BR:dmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desmer_4498
Exosome [BR:dmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desmer_4498
  Exosomal proteins of bladder cancer cells
   Desmer_4498
  Exosomal proteins of melanoma cells
   Desmer_4498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4703011..4703775)
Genome map
AA seq 254 aa AA seqDB search
MANRRKVIAGNWKMFKTVSEAEDYAIKFLEEVKDVTDLDVVLCAPFTALHALKNELEESI
VHLGAQNMAWAEEGAYTGEISARMLLDVACTYVILGHSERREMFGETDQDIAKKVQQALA
VGLTPIFCCGENLKLREEGKAAEWVKNQVASALSGISKDDLLRIIVAYEPIWAIGTGKTA
SSQDAQEMCANIRATLTELMGSASENVPILYGGSVKAENIGELMQEPDVDGALVGGASLD
PLSFAKLIKNASPM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggctaatcgacgaaaggttatcgccggaaactggaaaatgtttaaaactgtcagtgaa
gccgaggactatgccataaagtttttagaggaagtcaaggatgttacagacctagatgtt
gtcctctgtgctccgtttacggctctccatgctctaaaaaatgagttggaagaaagcatt
gtccatctgggtgcgcagaatatggcttgggcggaagagggcgcctataccggagagata
tcagcacgtatgctgcttgatgtcgcctgtacatacgtaatactcggtcactctgaacgc
cgggagatgtttggagaaacagatcaggacattgctaagaaagttcagcaggcattggcg
gtagggttaactcctatcttttgttgcggggaaaatttgaaacttcgtgaagaggggaag
gcagccgagtgggtcaaaaaccaagttgccagcgctctttccggaatatccaaagatgat
ctgttgaggataattgtggcctatgagcctatttgggcgattggcaccggtaagaccgca
tccagtcaagatgctcaagagatgtgtgctaatatccgtgcgactttgacggagctgatg
ggatcggcctctgagaatgttcctatactctatggaggcagtgtcaaagctgaaaatatt
ggggaactaatgcaggagcctgatgtagatggggctttagtcggtggggcaagtcttgat
ccccttagttttgcgaaacttatcaaaaatgcaagtccaatgtag

DBGET integrated database retrieval system