KEGG   Desulfococcus multivorans: Dmul_11540Help
Entry
Dmul_11540        CDS       T04568                                 

Gene name
atoB2
Definition
(GenBank) AtoB2: acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dml  Desulfococcus multivorans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmul_11540 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    Dmul_11540 (atoB2)
   00640 Propanoate metabolism
    Dmul_11540 (atoB2)
   00650 Butanoate metabolism
    Dmul_11540 (atoB2)
  Lipid metabolism
   00071 Fatty acid degradation
    Dmul_11540 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    Dmul_11540 (atoB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmul_11540 (atoB2)
   00310 Lysine degradation
    Dmul_11540 (atoB2)
   00380 Tryptophan metabolism
    Dmul_11540 (atoB2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dmul_11540 (atoB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dmul_11540 (atoB2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dmul_11540 (atoB2)
Enzymes [BR:dml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dmul_11540 (atoB2)
Exosome [BR:dml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmul_11540 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1290804..1291979
Genome map
AA seq 391 aa AA seqDB search
MREAVIVSAVRTPLGAFNGALGNIGATDLGGMVIAEAVKRAGIAKEAVDEVLMGQVLPCG
YGQNPAKQAAVKAGLPWEAECITVNKVCGSALKTVMLAAQAVQVGDADIVVAGGMENMSL
APYYLEKARFGYRMGPGKLQDSMIHDGLWDIVNDFHMGMSNELCSEKYGVTREDQDRYAA
ESYRRAVAAISSGRFKDEILPVEIPQRKGAPKIFDQDECARETSYEALSRMSGAFKKGGL
GTAGNASIISDGAAAVVVMAREKAETLGCRVLATIGAQASYGIDMKYVLVAPIWAIPKCL
AKEGISMDEVDLFEINEAFSGSSVAILKELKIDAAKVNVNGGAVALGHPIGASGCRVLVT
LLYEMARQDKKIGLASLCLGGGEAVAMIVKR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcggtaattgtgagtgcggtgagaacccccttaggcgccttcaatggcgcc
ctcggcaacatcggcgccacggatctgggcgggatggtcatcgccgaggccgtcaagcga
gctggaatcgccaaggaggcggtggacgaggtgttgatgggacaggttttgccttgcgga
tatggacagaatcccgccaaacaggcggcggtcaaggccggtctgccgtgggaggccgaa
tgcatcactgtaaacaaggtgtgcggttcggctctcaaaaccgtcatgttggctgctcag
gctgtccaggttggggatgcggatatcgtcgtggccggcggcatggaaaatatgagcctg
gcaccctattatcttgaaaaggcccgcttcggctaccggatgggacctggaaaacttcag
gattccatgattcatgacggcctgtgggacatcgtcaatgattttcacatggggatgtcc
aatgaactctgctccgaaaaatacggtgtgactcgagaagatcaggatcggtatgccgcg
gagtcctaccgtcgtgccgtagccgccatctcctccggacgctttaaggatgagattctt
ccggtggagattccccaacggaaaggcgcaccgaagattttcgatcaggatgaatgtgcc
cgagagacgtcctacgaggccctttcccgaatgagcggcgccttcaaaaaaggcgggctc
ggcactgccggaaacgcctctatcatcagcgacggtgcggcggccgtggtcgtcatggcg
agggaaaaggccgagaccctggggtgtcgtgttctggcgaccatcggtgctcaggcatcc
tacggcatcgatatgaagtatgtcctcgtggctcccatatgggccatccccaagtgcctc
gcgaaagaaggcatctccatggatgaggttgatcttttcgagattaacgaggccttcagc
ggatccagtgtggccatcctgaaagaactcaagatagatgccgccaaggtcaacgtaaac
ggtggcgcggtggccctgggacatcccattggcgccagcggttgccgggtgctcgtgacc
ctgctttacgaaatggcccggcaggacaagaaaatcgggctggcatccctctgtctgggc
ggcggagaagccgtagccatgattgtaaagcgatag

DBGET integrated database retrieval system