KEGG   Desulfococcus multivorans: Dmul_30450Help
Entry
Dmul_30450        CDS       T04568                                 

Gene name
thlA
Definition
(GenBank) ThlA: acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dml  Desulfococcus multivorans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmul_30450 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    Dmul_30450 (thlA)
   00640 Propanoate metabolism
    Dmul_30450 (thlA)
   00650 Butanoate metabolism
    Dmul_30450 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    Dmul_30450 (thlA)
   00072 Synthesis and degradation of ketone bodies
    Dmul_30450 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmul_30450 (thlA)
   00310 Lysine degradation
    Dmul_30450 (thlA)
   00380 Tryptophan metabolism
    Dmul_30450 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dmul_30450 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dmul_30450 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dmul_30450 (thlA)
Enzymes [BR:dml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dmul_30450 (thlA)
Exosome [BR:dml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmul_30450 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3415026..3416315
Genome map
AA seq 429 aa AA seqDB search
MNEVVIVSGSRTAVGSFGGSLKTVSVVDMGALVMKDVLKKANLKPVLSDDMRAGVPEKLK
DQGPVDLEKQAADWDDGATPIVIDEVIMGNVLQAGQGQNPARQAMIRAGICKETPAMSLN
KVCGSGLKAIAVGASAIMSGQAEVVLAGGQENMSMAPMALPKARWGYRMELTGAGEVTDL
VVFDGLYEIFYGYHMGMTAENIVKLYGISREEQDELGVLSHNRARKAITDGLFKEEIVPV
VIKSRKGDVVFDTDERPMDTSLEKMARLKPAFKKDGSVTAGNASGINDAAAAVLMMTPEK
AKALGLQPIVRIKAFAGGGVDPAYMGLGPVPAIRKVLKTTGMTLNDIQMIELNEAFAAQA
IGCMRELDIPVEKPNQLGSGISIGHPIGCTGARQMVTCIHHMRRENLETGLISMCIGGGM
GMAMIVERV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgttatcgtcagcggctcgcggaccgctgtaggcagtttcggaggatcg
ctcaaaaccgtttcggtggtggatatgggagcactggtcatgaaagacgtcctgaaaaag
gcgaatctcaagcccgtgctgagcgacgacatgagagcgggcgttccggagaaactgaag
gaccaggggcccgttgaccttgaaaaacaggctgcggactgggacgacggcgccacgccg
atagtcatcgacgaggtcatcatgggaaacgtcctgcaagccggccagggtcagaatccc
gcccgtcaggccatgatccgggccggcatctgcaaggagacgccggccatgagtttgaac
aaggtctgcggttccgggctcaaggccatcgccgtcggtgcatcggccatcatgtccggt
caggcggaagtcgtgctggccggcggtcaggaaaacatgagcatggctcccatggctctg
cccaaagcccggtggggctatcgtatggaactgaccggcgcgggagaggtcacggacctg
gtggttttcgacggactctatgaaatcttttacggatatcacatgggcatgaccgccgaa
aacatcgtcaaactttacggcatcagccgtgaggagcaggacgaactcggcgtactgagc
cataatcgggcccgcaaggccatcaccgacggccttttcaaggaagagatcgtgcccgtg
gtcatcaagagccgcaagggcgacgtggttttcgacacggacgaacgccccatggacacc
tccctcgagaagatggccagactgaagccggccttcaagaaagacggctccgtcaccgcc
ggaaacgcctccgggatcaacgacgccgccgccgcggtgctcatgatgacccccgaaaag
gccaaagccctcggacttcagcccatcgtcaggatcaaggccttcgccggcggcggcgtg
gatccggcatacatgggcctggggccggtgccggcgattcgaaaggtgctgaaaaccacc
ggcatgaccctgaacgacatccagatgatcgagttgaacgaggcgtttgcggctcaggcc
atcggatgcatgcgggaactcgacatccccgtcgaaaaacccaaccagttgggcagcggc
atctccatcggccatcccatcggctgcaccggcgcccgtcagatggtgacctgcatccat
cacatgcgccgggaaaacctggaaaccggcctgatctccatgtgcatcgggggcggcatg
ggaatggccatgatcgtcgagcgcgtatag

DBGET integrated database retrieval system