KEGG   Drosophila mojavensis: Dmoj_GI10137Help
Entry
Dmoj_GI10137      CDS       T01062                                 

Definition
GI10137 gene product from transcript GI10137-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dmoj_GI10137
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI10137
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI10137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 908 aa AA seqDB search
MAQLKKLHMADKLEDLEKWTEIKDVRNKSMKILLNTARKLYLTAEQYRRDGDQELAYITY
VKYFNMLAAIREKSDYNQHKLTVRQVLGDTESNRRIMDTLELLSKSLSTRYEQLMPPENQ
NGADTMNLPLPPGEPIGEPSTLATTTPTYAQLGLISCEELFQRMQQNSVLVMDCRSSADY
ENSHLTYYCAFNVPEELIMPGMSAGKLQARLSSSAKAAWASRSVKESVVLMDWNTKDAQP
AGNAAIYTLLDILKNWDPDVTYRSPIQILEGGYEFFIMMYPTHCTNPSVQPPQQNNNDIE
TIDDIEYPSINDITMKEDIMNAPNVMHKQRPSINRANKPAAVRTYEQSSPNQQQQQQPAE
PQDNPINDIIRDQTVLLQRAHHNDMLLDTAAKKWQSIIELKQLHAEGAVLSYPEQEVLYN
ILQLESKAEDYKIENNRLRDELNRYKEQNAMQYLQNDDETTKRIESKIQERQQLDEQHER
DRLEREHQLSIARAAKKHYKPPAETNAARPLTPTGDALNNAFNELPQTIVSEEPAIRPAY
DRSTKPQSRNVETTAPRVRDFSPVIGHNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLME
FCVSDKYKNYICRRNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVD
QQDSHEFLTILMDWLHSDLQTLRVPRQREVISASEKAWMEFTKSQESLILHLFYGQIKST
VKCVTCTKESATYECFSNLSLELPANANLCYLNQCMDMYFSGEKIHGWNCPNCKTKRDAI
KKLDISKLPPVLVIHLKRFYADPSNPGAYIKKQNYLQFPLDNLDMKPYIARAESRAVTPK
TYQLYAVSNHYGTMEGGHYTAFCKSAHYGRWYKFDDQVVSPLDTSNVVSSAAYILFYTWL
PPMQLSIS
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactaaagaaactgcacatggccgacaaattagaagatctggagaagtggact
gagataaaagacgtgcgtaacaagagcatgaaaattttactaaacacagctcgtaagctg
tacctgaccgctgagcagtatcgccgggatggggaccaagagctggcctacatcacctac
gtgaagtatttcaatatgctggcggccatacgcgaaaaatcggattacaatcaacacaaa
ctgacagtgcggcaagtgctgggcgacacggaatccaatcgccgcatcatggacaccctg
gagctccttagcaaatctctgagcacacgctatgagcagctgatgccgccagaaaatcag
aatggtgcagatacgatgaacttgccattgccgccaggggaaccaattggcgagcctagc
acattggccacgacaactccgacatatgcccaattgggtttaatcagctgtgaagaactc
ttccagcgcatgcagcagaactctgtgctggtcatggattgtcgcagcagcgccgattac
gagaactctcatttgacctactattgtgcatttaatgtgcccgaagagctgataatgccg
ggcatgtcggcgggtaagctgcaggcacgcctaagcagcagcgccaaagctgcatgggcc
tctcggtctgtcaaggagtcggttgtgcttatggactggaacaccaaagatgcccagccc
gcgggcaatgcagctatatacacactgttagacatattgaaaaactgggatcccgatgtt
acttatcgctcgcccatacagattttggagggcggctacgagtttttcatcatgatgtat
ccgacgcactgcaccaatccgagtgtccaaccgcctcagcagaacaacaatgacatcgaa
acgattgatgacatcgagtatccatccataaatgacataactatgaaggaggatattatg
aatgcgcccaatgtgatgcataagcaaaggcccagcataaatcgtgccaacaaaccggct
gcagtgcgcacctatgagcagagctcaccaaatcagcagcaacagcaacagcctgctgag
ccacaggataaccctatcaatgacatcatacgcgatcagacagtgctgctgcagcgggca
catcacaacgatatgctactcgatacggcggccaagaagtggcaaagcataattgagcta
aagcaactgcatgccgagggcgcagtgctaagctatccagaacaggaggtgctatacaac
atattgcagctggaaagcaaggctgaggactataaaattgagaacaatcgactgcgcgat
gaactgaatcgctacaaggagcaaaatgcgatgcagtatttgcaaaatgatgatgagaca
accaaacgcattgaatcgaaaatacaggagcgacagcagctggacgaacagcacgaacga
gatcgcctcgagcgcgagcaccagctgtccattgcacgcgcagcgaaaaaacattataag
ccaccggcagagaccaatgcagcccgcccactcacacccacaggcgacgcattgaacaat
gcattcaacgaattgcctcagacgattgtatccgaagagccagcaatccgacccgcctac
gatcggtcaacgaaaccacagagccgtaatgtggagacgacagcgccacgagtccgtgat
ttctcacctgtaatagggcacaatgtgggccgcggcttaacgggcctcaagaatcttggc
aacacctgctatatgaatagcatactacaatgtctgagcaatacgccacagctaatggag
ttctgcgtatcagacaaatacaagaactatatatgtcggcgtaacaaaaccaatggacag
gtcatcgaggaggtggccgcactcatcaaagagctgtggaacggacaatataaatgtgtg
gccagtcgcgatttgcgatacgttgtgggacagtatcagaagatatttcgcggcgttgat
caacaggattcccatgaatttttgaccatactcatggactggctgcattcggatttgcaa
acgttgcgtgtgccgcgccagcgagaggttatcagtgcctcagagaaagcgtggatggag
tttaccaagtcgcaggagagtctaatactgcatttattttatggtcagatcaagagcacc
gtcaagtgtgtgacctgcaccaaggagtcggccacatacgagtgtttttcgaatctcagc
ctggagctgccggcaaatgcaaatttgtgctatctgaatcaatgcatggacatgtacttc
agtggcgagaaaattcacggctggaactgtcccaactgtaagacgaaacgagatgccatc
aaaaagttggatatatccaagctgccaccggtgctggttatacatttgaagcgtttctat
gcggaccccagcaaccctggcgcctatattaagaaacaaaactatttacaatttccgctg
gataatctggacatgaaaccatatatagcacgtgccgaatcacgtgctgtgacgcccaaa
acataccaattgtatgccgtgtccaatcactacggcaccatggagggcggacattataca
gcattctgcaagagcgcccactatgggcgctggtataagttcgatgatcaagttgtttcg
ccgctggacacgtcaaacgttgtctcgagcgcagcctatatactattttatacctggctg
ccgcctatgcaactatcaatatcatag

DBGET integrated database retrieval system