KEGG   Drosophila mojavensis: Dmoj_GI10280Help
Entry
Dmoj_GI10280      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00010  Glycolysis / Gluconeogenesis
dmo00260  Glycine, serine and threonine metabolism
dmo01100  Metabolic pathways
dmo01200  Carbon metabolism
dmo01230  Biosynthesis of amino acids
Module
dmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dmo_M00002  Glycolysis, core module involving three-carbon compounds
dmo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI10280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmoj_GI10280
Enzymes [BR:dmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dmoj_GI10280
Membrane trafficking [BR:dmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dmoj_GI10280
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dmoj_GI10280
  Exosomal proteins of melanoma cells
   Dmoj_GI10280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 6574497
NCBI-ProteinID: XP_002000541
FlyBase: FBgn0133045
UniProt: B4KDY1
Position
Unknown
AA seq 293 aa AA seqDB search
MIVLPRLACASPSLSPCSGGNQKGCNCAAMQQPLRRSSSCDKFVVVMVRHGESEWNQKNL
FCGWYDAQLSEKGQKEAIAAGKAIKDAKMKFDIAHTSVLSRAQKTLDIILKECGQEGIPI
QRSWRLNERHYGGLTGLNKADTAKKYGEDQVKIWRRSFDTPPPPMEQDHQYYECITKDPR
YCDGPKPSEFPKTESLKLTIERTMPYWNKVIVPQIREGKKLIIAAHGNSLRGIVKYLDKI
SDQAIMELNLPTGIPFIYELDASMAPLTSMKFLGDPETVKKAMEAVAKQGKAK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattgttctaccaagacttgcttgcgccagtccttccctcagcccctgttccgggggc
aaccagaagggctgcaactgcgcggcaatgcagcagccgctgcggcgctcgagtagctgt
gataagttcgtggtggtgatggtgcggcacggtgagtccgagtggaaccagaagaatctc
ttttgcggctggtacgacgcccagctgagcgagaagggacagaaggaggcgattgcggcg
ggcaaggccatcaaggatgccaaaatgaagttcgatatagcgcatacgtcggtgctgtcg
cgagcgcagaaaacgctcgatatcatactgaaggaatgtggacaggagggcataccgata
cagaggtcgtggcgcctcaacgagcgccactatggcggtctgacggggctcaacaaggcg
gacactgccaagaagtatggcgaggatcaggtgaagatctggcgtcgcagcttcgacacg
cccccgccgcccatggagcaggatcaccagtactacgagtgcataaccaaggatcccaga
tactgcgatgggcccaagccctcggagtttcccaagaccgagtcgctgaagctgaccatc
gagcgcaccatgccctactggaacaaggtgattgtgccccagataagggagggcaagaag
ctgatcattgccgcgcacgggaacagcctgaggggaatcgtcaagtatctggataagatt
tccgaccaggccatcatggagctgaacctgccgacgggcataccctttatctatgagcta
gacgccagcatggcgccgctgacgtccatgaaatttctgggtgatcccgaaacagttaag
aaggccatggaagccgtggccaagcagggcaaggctaagtag

DBGET integrated database retrieval system