KEGG   Drosophila mojavensis: Dmoj_GI10359Help
Entry
Dmoj_GI10359      CDS       T01062                                 

Definition
(RefSeq) GI10359 gene product from transcript GI10359-RA (EC:3.1.1.- 3.1.1.1)
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmoj_GI10359
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dmoj_GI10359
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dmoj_GI10359
  Exosomal proteins of breast milk
   Dmoj_GI10359
Glycosaminoglycan binding proteins [BR:dmo00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   Dmoj_GI10359
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dmo00537]
 Enzymes
  Dmoj_GI10359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 438 aa AA seqDB search
MATQGPAVQGKVTNEVESAVMRAKAAAERLQLNANEKSKASHAGMQIVRTSNQDISSMNL
MTPAVLPISERHNFENNNNNNNSNTDKNSTGPMVGDEQLLRLQDYNLLYNAERQTYFQLH
SSSRRGPSGLSYGNRLLQQYVGNKLSAAFGLNVNDGKESIMQLTTQTVRLYDAASLRQSH
FNPFQPTRIIIHGWLGNAHANVYNYLVPAYLKLSDGSYNIFTVDWGRGAIADYITASYRV
KPVGQVLAKFLDFLHVEAGMQFEDLQLIGFSMGAHIAGLAAKHVQTGHVRVIRALDPALP
FFRYAQEKERLSRNDASYVEVLHTSVGSYGFDRPLGHVDFYANWGSQQPGCFWHECSHWR
AFALFKESLEGTVFEARGCQPSEWQQLTRHKRCPQPTGSRLHMGGDLGTLSMEQLAQREG
VYYFETQARPPYDMGPAT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaaggacccgcagtgcaaggaaaagtgacaaatgaagtggaaagtgccgtg
atgagggcgaaagcagcagccgaaagactgcagctaaatgcaaatgaaaagagcaaggcc
agtcatgcaggcatgcaaatcgtaaggacatctaaccaggacatcagcagcatgaactta
atgacacccgctgtgttgccaatatcggaaagacataatttcgaaaacaacaacaacaac
aacaacagcaacactgacaaaaactcgactggcccaatggtcggtgatgagcaactatta
cgattgcaggactacaatttactatacaatgccgagcgacagacctactttcagctgcat
tcgagcagtaggcgtggcccgagcggactatcgtatggtaatcgcctgctgcagcagtac
gttggcaacaagctgagcgctgccttcggcctgaatgtcaacgacggcaaggagtcaatc
atgcagctgaccacgcagacggtgcggctctacgatgccgcttcgctgcgccaatcacac
ttcaatcccttccagcccacgcgaatcataatccatggctggctgggcaatgcacatgcc
aatgtctacaattacttggtgcccgcgtacctgaagctcagcgatggcagctacaatatt
ttcactgtcgactggggacgtggtgccatcgccgattatataacggccagctatagagtg
aagccagtgggtcaggtgctggccaagtttctggactttctgcacgtggaggcgggcatg
cagtttgaggatctgcagctgattggcttcagcatgggcgcccatattgccgggctggcc
gccaagcacgtgcagaccggtcatgtgcgtgtgatacgcgccttggatccggccctgccc
ttctttcgctacgcccaagagaaggagcgcctcagccgcaacgatgccagctacgttgag
gtgctgcacacgagcgtgggcagctacggattcgatcgtccgctgggccacgtagacttc
tacgccaactggggtagccagcagccgggctgcttctggcacgaatgcagccactggcgt
gcctttgccctattcaaggagagcctggaggggacggtcttcgaggccaggggctgtcag
ccaagcgaatggcagcagttgacgcgccacaaacgctgcccgcagccaacgggcagccgg
ctccacatgggcggagatttgggcacactatccatggagcagctggcgcagcgcgaggga
gtttattatttcgagacccaggcgagaccgccctatgatatggggccagcgacatag

DBGET integrated database retrieval system