KEGG   Drosophila mojavensis: Dmoj_GI10403Help
Entry
Dmoj_GI10403      CDS       T01062                                 

Definition
GI10403 gene product from transcript GI10403-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dmoj_GI10403
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI10403
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI10403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1124 aa AA seqDB search
MLEYEIYELKEEQVRLPPISSNNTTTNNKSPKTRQNTYILLKSNTLLKSKASTTSATTTE
SGEPSLPAPTCSVIYPEIQEYVDQVAQPQQTSHKDIEAVPKRKRTRRVYVAELSRCASLR
SRQPAAVNLPPIPEKASSPSPTAQSSPTPTEAAEYHKYIKLEHFKPEFWNRIEEEPEPKV
TGRKRRGGGGGVNVSGRNRKRRSKIETDSNFSAETAAAIAAAQIELDSNKPASRAFRKRK
RSCNMSLYDRRYQTTTDEQRRVANGYASGGPGLRAGNSSVTGDNDSTELQSHQYYGPAGG
SNSSGASSIPGSGLNGSGGTALNHVPTMGTLCNIGNTCYLNSVVYTLRFAPHFLHNLHHL
IQDLNVVQQAIQRQQNAKSASLGRNVSGSGGAQLEHARSWSSKDLATTDPYNSTSNGSGS
NAASSGSKKSTHQSVSEKLHDLYSSLHGNEMADSSEPYHADTLLHAIQDVNATFEGNQQQ
DAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDDTDTVDSMERSDVGNHALMS
ASGNGSIATSQNQSTTTTKTSFFSRKSKRKDEVKSSKATRLQSPLKDNSPTTAGGGIGTT
HVASNSLFYLNTVDLSGAPAASAAAAAGANTTASAASTAPAKYSSDDEINTASLLKDKMR
LEERIRELNINFFNSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNAELQEK
PSAYIQNSCITREYFRGDNKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVS
TYVPTTFTLPCFCAKCCELSDANKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYV
NCPKDRRNATSSAQQQQSAAPAAGNENAAPSNNGISSIASLPVSAAASALASSGTSLMKK
MKFGRNKASSSGDMSKNVKQVNGFTSKTITNGIGKLSMNTTCQGINCCAMRLCCSQQASM
AGSTTASNSDFSEESLQNGSNSNLSYGSSTNSCASYPTGYGSTGRGGVKANYTQGNSSEP
IWYMCDDDKIKAMTQREFEELLSPTRKITITPYLLFYARFDLQPATPQKPSSSSTPPPPQ
PTSAVSASSAAAAAAAAAAVAVPAQQLPQSSWSNDNLQSGLHKI
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaatatgaaatatatgagctgaaagaggaacaagtacgtcttccgccaatcagc
agcaacaacaccaccaccaacaataaaagcccaaaaacacgtcagaacacgtacattttg
ttgaagtccaacactttactgaaatccaaagcttccacaacatctgcaacgactactgaa
tccggtgagccgtcgctgccagcaccaacgtgttcggtcatatatccagagatacaagag
tacgtagatcaggtcgcacagccccaacaaacaagccacaaagatatcgaggcggtgcca
aagcgtaaacgtactcgacgtgtttatgtggcagagctctcgcgttgtgccagtctaaga
tcaaggcaaccagcagcagttaacctaccacccataccggagaaagcgtcaagtccatca
ccgacagcacagtcatcgcctacgcccacagaggctgccgagtatcataagtatatcaag
ttagaacatttcaaacccgagttttggaatcgcattgaagaggagccagaaccgaaagta
actggaagaaagcgacgcggaggtggcggaggtgtcaacgtcagcggtagaaatcgcaag
cgtcgttctaagatcgagaccgattctaatttctcagcggagacagcagcggccatcgct
gcggctcaaatcgagcttgattcgaataaaccggcgtcgcgcgcttttcgcaaacgcaaa
cgcagctgcaacatgtcgctatacgatcgacggtatcaaacaaccacagacgaacagcgg
cgcgtggccaatggctatgcgtctggcggccctggtctgcgagctggcaattcatccgtt
accggagacaacgattcaaccgaactgcagagccatcagtattatggcccagccggtggc
agcaattcgagcggcgccagctccatccccggcagtggactaaatggcagtggtggtaca
gcattgaatcatgtgcccactatgggaacgctgtgcaacatcggcaacacttgctattta
aattcggtggtgtatacgctgcgttttgccccgcatttcctgcacaatttgcatcatctg
attcaggatttgaatgtggtgcagcaggcgatacagcgtcaacagaatgccaagtccgcc
tcgctgggccgcaacgtgagcggcagcggtggcgctcaattggagcacgcacgcagctgg
agcagcaaagatctggccacaacagacccgtacaacagcaccagcaatggcagcggcagc
aacgccgccagcagcggaagcaagaagtcaacacatcagtcggtcagcgagaagttgcac
gatctgtacagcagtctgcatggcaatgagatggccgactccagtgagccctatcatgcg
gacaccctgttgcatgccatacaggacgtcaatgccacattcgagggcaatcaacagcag
gatgcgcacgagtttctaatgtgtgtgctgaattgtatacgcgaaacgaatcagtcgctg
ataaaggccattggcgagtgtccggaagtgattgcgaacggctacattgccaatcctgat
gatacggatacggtcgattccatggagcgctctgatgtgggaaatcatgcgctcatgagc
gcttccggcaatggctcgatagcaactagtcaaaatcaaagtaccacaacaacaaaaaca
tcatttttttcacgaaaatcaaagagaaaagatgaagtgaaatcctcaaaggcgacacga
ttgcagtcaccgctcaaagataatagtccaaccacagctggcggtggcataggaaccacc
catgtcgcctccaatagtctcttttatttaaacacagtcgatctcagcggtgctccagct
gcttcagctgctgctgctgctggtgctaataccacagcatcagctgcatcgaccgcacct
gcaaaatattccagtgatgatgaaatcaatacggctagtctgctcaaggataaaatgcgt
ttggaggagcgcatccgcgagctgaatatcaactttttcaactctgattttgaaggtatt
gtggtgctgaccaccaaatgcctgagctgtgaaacaattacgcgtcagaagcaaggcatg
ctcgatatctcagtacctgtgccgatttcgggctatgataatgccgaattgcaggaaaaa
cccagcgcctatatacagaactcttgcataacgcgtgaatattttcgcggcgataacaaa
tacagctgcaatcagtgtacgggctacactgaggccatacgctccatatcgtatgaagtg
ctgccccgtctactggtcatccaactgaatcggttctcgggcggcatggagaaggtcagc
acctatgtgcccacaacatttacgctgccctgcttctgtgccaagtgctgtgagctgagc
gatgccaacaagctgcacgtttacaagttgtacagcgtcataacgcacgttggcgccacg
ttaacagtgggtcattatatagcgtacacctgcttcttggacctggccagtgattacgtt
aattgccccaaggatcgacgcaatgcgacaagcagcgcacaacaacagcagtcagcggca
ccagcagctggcaatgagaacgcggcgccaagcaataatgggattagcagcattgccagc
ttaccggtgtcagcggctgcctcggctttggcctcgtcgggcaccagtttgatgaagaaa
atgaaattcggccgcaacaaagcatccagcagcggcgacatgagcaaaaatgtgaagcaa
gtgaacggattcaccagcaagaccatcaccaatggcattggcaagctcagcatgaacacc
acctgccaaggcatcaactgttgcgcgatgcgcctgtgctgcagccaacaggcgagcatg
gcgggcagcactaccgccagcaacagcgacttcagcgaggaatccctgcagaatggcagc
aacagcaatctcagctatggcagcagcaccaacagctgtgcgtcgtatcccacgggctat
ggcagcacggggcgcggcggagtcaaagccaactatacgcagggcaacagcagcgagccc
atttggtatatgtgcgacgatgataagatcaaggcgatgacacaacgggaattcgaggag
ctgctatcgccgacgcgcaaaattacaattacaccatatttactgttctatgcacgcttc
gatttgcagccggcgacgccacagaagccgagctcatcatccacaccgccaccaccgcag
cccacgtcagcagtgtcggcgtcgtccgcagcagcagcagcagcagcagcagcagcagta
gcagtgccggcgcagcagctaccgcagagctcctggtcaaatgataatctgcaaagtggc
ttgcacaagatttga

DBGET integrated database retrieval system