KEGG   Drosophila mojavensis: Dmoj_GI10484Help
Entry
Dmoj_GI10484      CDS       T01062                                 

Definition
GI10484 gene product from transcript GI10484-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dmo  Drosophila mojavensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dmoj_GI10484
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dmoj_GI10484
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dmoj_GI10484
Lipid biosynthesis proteins [BR:dmo01004]
 Desaturase
  First
   Dmoj_GI10484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 367 aa AA seqDB search
MAVNSEAGPVLSNSKAGASKQTGVLFEDDAETNDGALDVNVIELKKAEKRKLKWVWRNII
LFVYLHMAALYGGYLLLTQAKWQTIVFSIFLYVAGMLGITGGAHRLWAHRAYKAKWPLRL
ILITFNTIAFQDAAFHWARDHRVHHKFSETDADPHNATRGFFFSHVGWLLCKKHPDVVAK
GKSLDLTDLRADRILMFQLKHYFVLMPLACFILPTVIPMMCWNESLLCSWFVSTMFRWCF
QLNMTWLVNSAAHKFGGRPYDKNINPSQSPYVSAFTFGEGWHNYHHVFPWDYKTAEWGNY
SLNMTTAFIDLFAKIGWAYDLKSVAPETVERRVRRTGDGSHELWGWGDKDMTAEDEQRVL
FVDTKTH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagttaactcggaggcggggccagtgctgagcaattccaaggctggagcctctaag
cagacgggcgtgctcttcgaagacgatgcggagaccaacgatggcgccttggacgtgaat
gttatagagctgaagaaggccgagaaacgcaaattgaaatgggtttggcgcaacataata
ctctttgtctacttgcacatggctgcgctctacggcggctatttgcttttgacccaagcc
aaatggcaaacaattgtgttctccattttcctgtacgttgcgggcatgttgggcatcacg
ggcggcgctcatcgtctctgggcgcatcgtgcctacaaagctaagtggccgctacgcctg
atcctgatcaccttcaatacgatcgccttccaggatgccgccttccattgggcgcgcgat
catcgcgtgcatcacaagttctccgagacggatgccgatccacacaatgccacacgtggc
ttcttcttctcgcacgtcggctggctgctgtgcaagaagcatcccgatgtggtagccaag
ggcaagagcttggatctgaccgatctgcgcgccgatcgcatactcatgttccagctcaag
cactactttgttctcatgccgctggcctgcttcatattgccaacggtcatacccatgatg
tgctggaacgagtcgctcttgtgctcttggttcgtgtccacgatgttccgctggtgcttc
cagctgaacatgacctggctggtcaatagtgcggctcacaaattcggtggacgtccttac
gacaagaacattaatccgtcgcagagtccgtatgtctcggcctttacctttggcgagggc
tggcacaactatcatcatgtctttccctgggactacaagaccgccgaatggggcaactac
tcgctgaacatgaccacagcgttcatagatctattcgcgaaaattggatgggcctacgac
ctgaagtcagtggccccggagacagtggagcgacgagtacgccgcactggtgatggatcc
catgagctatggggttggggcgataaggatatgaccgcagaggacgaacagcgcgttctc
tttgtggacacgaaaacgcattaa

DBGET integrated database retrieval system