KEGG   Drosophila mojavensis: Dmoj_GI10484Help
Entry
Dmoj_GI10484      CDS       T01062                                 

Gene name
Dmoj_Desat2
Definition
(RefSeq) desaturase 2
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dmo  Drosophila mojavensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dmoj_GI10484 (Dmoj_Desat2)
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dmoj_GI10484 (Dmoj_Desat2)
Lipid biosynthesis proteins [BR:dmo01004]
 Desaturase
  First
   Dmoj_GI10484 (Dmoj_Desat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 379 aa AA seqDB search
MPPNAVSSPANDMAVNSEAGPVLSNSKAGASKQTGVLFEDDAETNDGALDVNVIELKKAE
KRKLKWVWRNIILFVYLHMAALYGGYLLLTQAKWQTIVFSIFLYVAGMLGITGGAHRLWA
HRAYKAKWPLRLILITFNTIAFQDAAFHWARDHRVHHKFSETDADPHNATRGFFFSHVGW
LLCKKHPDVVAKGKSLDLTDLRADRILMFQLKHYFVLMPLACFILPTVIPMMCWNESLLC
SWFVSTMFRWCFQLNMTWLVNSAAHKFGGRPYDKNINPSQSPYVSAFTFGEGWHNYHHVF
PWDYKTAEWGNYSLNMTTAFIDLFAKIGWAYDLKSVAPETVERRVRRTGDGSHELWGWGD
KDMTAEDEQRVLFVDTKTH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaatgctgtgagtagcccggcgaacgacatggcagttaactcggaggcgggg
ccagtgctgagcaattccaaggctggagcctctaagcagacgggcgtgctcttcgaagac
gatgcggagaccaacgatggcgccttggacgtgaatgttatagagctgaagaaggccgag
aaacgcaaattgaaatgggtttggcgcaacataatactctttgtctacttgcacatggct
gcgctctacggcggctatttgcttttgacccaagccaaatggcaaacaattgtgttctcc
attttcctgtacgttgcgggcatgttgggcatcacgggcggcgctcatcgtctctgggcg
catcgtgcctacaaagctaagtggccgctacgcctgatcctgatcaccttcaatacgatc
gccttccaggatgccgccttccattgggcgcgcgatcatcgcgtgcatcacaagttctcc
gagacggatgccgatccacacaatgccacacgtggcttcttcttctcgcacgtcggctgg
ctgctgtgcaagaagcatcccgatgtggtagccaagggcaagagcttggatctgaccgat
ctgcgcgccgatcgcatactcatgttccagctcaagcactactttgttctcatgccgctg
gcctgcttcatattgccaacggtcatacccatgatgtgctggaacgagtcgctcttgtgc
tcttggttcgtgtccacgatgttccgctggtgcttccagctgaacatgacctggctggtc
aatagtgcggctcacaaattcggtggacgtccttacgacaagaacattaatccgtcgcag
agtccgtatgtctcggcctttacctttggcgagggctggcacaactatcatcatgtcttt
ccctgggactacaagaccgccgaatggggcaactactcgctgaacatgaccacagcgttc
atagatctattcgcgaaaattggatgggcctacgacctgaagtcagtggccccggagaca
gtggagcgacgagtacgccgcactggtgatggatcccatgagctatggggttggggcgat
aaggatatgaccgcagaggacgaacagcgcgttctctttgtggacacgaaaacgcattaa

DBGET integrated database retrieval system