KEGG   Drosophila mojavensis: Dmoj_GI10635Help
Entry
Dmoj_GI10635      CDS       T01062                                 

Definition
(RefSeq) GI10635 gene product from transcript GI10635-RA
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MSSQNLRQHFNAKEDYTAILDKLKVDFEQRWKSQEPSPYTNLESYVQRAIIGNGSFGTVL
LVKEKKGKNYYAAKMMNKDDLVRLKQVGHVHNEKTVLSSVRFPFLVHLIDASKDFDYLYL
VLPFVNGGELFTYHRKVRKFNEKQSRFYGVQVLLALEYLHHMNLIYRDLKPENILMDARG
YIKVTDFGFTKRVDNRTSTLCGTPEYLAPEIIQLRPYSKSVDWWAFGILIYEFVAGHSPF
SMHNRDVILMYSKICLGEYRIPSFFTPQLKNLIENLLQSEPSKRLGNSTEGSTEIKSHAW
FQGVDWFAILNQDISPPFLPTVTSIEDLSNFENFESKTKLKSKINRHPDLFNNF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccagaacttgcgccaacattttaatgcaaaggaagactacacagccatactc
gataagcttaaggtggactttgaacagcgttggaagtcccaggaaccatcgccgtacacc
aaccttgagagttacgtgcagcgagcaatcattggcaatggcagttttggcactgttctg
ttggttaaggaaaagaaaggcaaaaattattatgcagctaagatgatgaataaggacgat
ctggtgcggctgaagcaagtcggtcacgtgcacaacgagaagaccgtacttagctccgtt
cgattcccatttcttgtgcacttgatcgatgccagcaaggactttgactatttgtatctt
gtgttgccgtttgtcaatggcggcgagctgttcacctaccatcgcaaagtgcgaaaattc
aatgagaagcaatcgcgattctatggggtccaagtgcttctggccctcgagtacttgcat
catatgaacctcatttatcgcgacttgaagccggagaatatcttaatggatgctcgcggc
tatattaaggtgacagatttcgggtttaccaagcgtgtggacaataggacgtcgacactt
tgtggtacacccgaatatttggcaccggaaatcattcaactgcggccgtactcaaagtcc
gttgactggtgggcgtttggtatactgatctatgagtttgtggctggccattcgccgttt
tcgatgcataatcgtgacgtcatattgatgtattcgaaaatttgcttgggcgaatatcga
ataccttcgttttttacgccccagctgaaaaacttgattgagaacttgttgcagagtgag
ccctcaaagcgtttaggtaactcaaccgagggctccacggaaatcaagagccatgcatgg
tttcaaggcgtcgactggtttgcaatccttaatcaagatattagcccgcccttcctaccg
accgttaccagtattgaagatttgtcaaattttgaaaattttgagtccaaaacgaaattg
aaatcgaaaataaatcgccacccagacttgtttaataatttttaa

DBGET integrated database retrieval system