KEGG   Drosophila mojavensis: Dmoj_GI10636Help
Entry
Dmoj_GI10636      CDS       T01062                                 

Definition
GI10636 gene product from transcript GI10636-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dmo  Drosophila mojavensis
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI10636
   04340 Hedgehog signaling pathway
    Dmoj_GI10636
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmoj_GI10636
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dmoj_GI10636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MDPQYFSPKVDYGVILDKLKDEFNKKFVRNTPSPSCGLDNFIIKATLGAGSFGKVQLVKE
KDGENYYASKQLSKDQIIKTKQVSHVMSEKKVLNSMCFPFTVNLISSFKDNDSLYLVLPL
IMGGELFTYHRKVRKFSEKQARFYAAQVFLALEYLHYCSLLYRDLKPENIMLDKNGYLKV
TDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLIYEFVAGHSPFATHS
RDVMVMYNKICEGDYKMPSAFSGPLRHLVDHLLQVDLSKRFGNLIGGNKDIKNHEWFKEV
EWIPLLNQTIQPPYTPTISNAEDISNFDKHNDAKQKPKSKTVKHEEAFVDF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcagtactttagtccgaaggttgactatggcgtcatactggataagctgaag
gatgagttcaacaagaagttcgttcgcaataccccatcgccgtcgtgtggtctcgataac
ttcatcatcaaggcgaccctgggtgctggctcgtttggcaaggtgcagttggtgaaggag
aaggacggcgaaaactattacgcctcgaagcagctgagcaaggatcaaattatcaagacc
aaacaggtctcgcatgtcatgagcgagaaaaaagtgctcaactcaatgtgctttccattc
accgtcaatctgatatcatcgtttaaggacaacgacagcctctacctcgtcctgccgctt
ataatgggtggcgaactctttacctatcatcgcaaagttcgcaaattcagcgaaaaacag
gcgcgcttctatgcggctcaggtgtttctcgccctggaatatctccactattgcagtctt
ttgtatcgcgatctgaagcccgagaatattatgctcgataagaatggctacctgaaggtg
acggattttggctttgctaaaaaagtggagacgcgtacaatgaccctgtgtggcacgccg
gagtatctgccaccggagataatacagtcaaagccctatggaaccagcgtcgattggtgg
gcctttggtgtgctaatctacgagtttgttgccggccattcgcctttcgccacccacagt
cgcgacgtcatggtcatgtacaacaagatctgcgagggggactacaaaatgcccagtgct
ttctcggggcctttgcgtcatctggtggatcatttactgcaagtggatctttcgaaaaga
tttggcaatttaattgggggcaacaaggacatcaagaaccatgagtggttcaaggaagtg
gagtggataccgctgctcaaccagaccatacagcccccatacacgcccacaatttcgaat
gccgaggacatttctaacttcgacaagcacaacgatgctaaacagaaaccaaagtcaaag
accgtcaagcacgaagaagcttttgtagatttctaa

DBGET integrated database retrieval system