KEGG   Drosophila mojavensis: Dmoj_GI10661Help
Entry
Dmoj_GI10661      CDS       T01062                                 

Definition
GI10661 gene product from transcript GI10661-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dmo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 398 aa AA seqDB search
MASMSENGIVLKEYQKKLKTMKKKYFVLHKETRTKKARLVYYDSEKKFLQNAPPKREIYV
ADCFSINRRLDTKHKYVLAISSKDGGFGIVMNSEEDLKKWLTNLLYIQRNTNGTQIEYDH
VWQVVVQKKGISESVGITGTYHCCLTSKSLTFECFGNEVDRIYKVEILLNTIRRCGHASP
QNIFFMELGRQSVLGAGELWMETEDAAVAKHMHDKILSAMSAKTESNMNLLNVQKGLSDL
SSEPMRKRSSSANEASKPINVLQKRQNPIETRSSFSPQYNSYGRERCDSLPTRSRTLSEC
SNHTYVELKNAQRCNTISGTRSYLIQRNIDSPISYSMKCSESEGSSISIDDAYDKSVHDA
YRINSITSKAMIPEENIDDDFLDSNKVSRITGNHSTKM
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatgtcagagaacggaatagtactaaaggaatatcaaaagaaattgaaaaca
atgaaaaagaaatattttgttttgcacaaggaaacaagaactaagaaagcaagattggtg
tattacgatagtgaaaagaaatttcttcaaaatgcaccaccaaaacgcgagatatatgtg
gcagattgctttagtataaatcgacgacttgacaccaaacataagtatgtcttagccata
tcatcaaaagatggcggctttggaatcgttatgaattccgaagaagacttaaagaaatgg
ttaaccaacttgctatacattcaacgaaatacaaacggaactcagatagagtacgaccat
gtttggcaagttgttgtccaaaaaaaaggcatttctgaaagtgttgggattacgggcacc
tatcattgctgcctaacatcgaagtcactaacatttgaatgctttggaaatgaagttgat
cgaatttataaagttgaaatacttttaaacacgataagaagatgtggtcacgcctctcca
caaaacatttttttcatggaactggggcgacagagtgttttgggcgctggtgaactttgg
atggaaacagaggatgcagcagttgctaaacatatgcacgataagatattaagcgcaatg
tctgctaaaacggagtcgaatatgaatcttttaaatgtacaaaaaggactttcggacctg
agcagtgagccgatgagaaagcgatcttcatcagccaatgaggcgtccaaacctattaac
gttttacaaaagcgtcaaaatcctattgaaacacgaagtagtttttcaccgcagtacaac
agctatggacgagaacgctgcgacagcttaccaactagaagtcggacgttgagcgaatgc
agtaatcatacttatgttgaattgaagaatgcgcaacgctgtaatacgatatcgggaacg
cggtcatatttaattcaaagaaacattgacagcccaatatcatattcaatgaagtgctct
gaaagcgaaggatcatccataagtattgacgatgcctatgataaatctgtgcatgacgct
tatcgaataaattcaataacttccaaggcaatgatacccgaagaaaatattgatgatgat
tttttagatagtaataaagtctcgcgaatcactggtaatcatagcacaaaaatgtaa

DBGET integrated database retrieval system