KEGG   Drosophila mojavensis: Dmoj_GI10661Help
Entry
Dmoj_GI10661      CDS       T01062                                 

Definition
GI10661 gene product from transcript GI10661-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI10661
   04150 mTOR signaling pathway
    Dmoj_GI10661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 398 aa AA seqDB search
MASMSENGIVLKEYQKKLKTMKKKYFVLHKETRTKKARLVYYDSEKKFLQNAPPKREIYV
ADCFSINRRLDTKHKYVLAISSKDGGFGIVMNSEEDLKKWLTNLLYIQRNTNGTQIEYDH
VWQVVVQKKGISESVGITGTYHCCLTSKSLTFECFGNEVDRIYKVEILLNTIRRCGHASP
QNIFFMELGRQSVLGAGELWMETEDAAVAKHMHDKILSAMSAKTESNMNLLNVQKGLSDL
SSEPMRKRSSSANEASKPINVLQKRQNPIETRSSFSPQYNSYGRERCDSLPTRSRTLSEC
SNHTYVELKNAQRCNTISGTRSYLIQRNIDSPISYSMKCSESEGSSISIDDAYDKSVHDA
YRINSITSKAMIPEENIDDDFLDSNKVSRITGNHSTKM
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatgtcagagaacggaatagtactaaaggaatatcaaaagaaattgaaaaca
atgaaaaagaaatattttgttttgcacaaggaaacaagaactaagaaagcaagattggtg
tattacgatagtgaaaagaaatttcttcaaaatgcaccaccaaaacgcgagatatatgtg
gcagattgctttagtataaatcgacgacttgacaccaaacataagtatgtcttagccata
tcatcaaaagatggcggctttggaatcgttatgaattccgaagaagacttaaagaaatgg
ttaaccaacttgctatacattcaacgaaatacaaacggaactcagatagagtacgaccat
gtttggcaagttgttgtccaaaaaaaaggcatttctgaaagtgttgggattacgggcacc
tatcattgctgcctaacatcgaagtcactaacatttgaatgctttggaaatgaagttgat
cgaatttataaagttgaaatacttttaaacacgataagaagatgtggtcacgcctctcca
caaaacatttttttcatggaactggggcgacagagtgttttgggcgctggtgaactttgg
atggaaacagaggatgcagcagttgctaaacatatgcacgataagatattaagcgcaatg
tctgctaaaacggagtcgaatatgaatcttttaaatgtacaaaaaggactttcggacctg
agcagtgagccgatgagaaagcgatcttcatcagccaatgaggcgtccaaacctattaac
gttttacaaaagcgtcaaaatcctattgaaacacgaagtagtttttcaccgcagtacaac
agctatggacgagaacgctgcgacagcttaccaactagaagtcggacgttgagcgaatgc
agtaatcatacttatgttgaattgaagaatgcgcaacgctgtaatacgatatcgggaacg
cggtcatatttaattcaaagaaacattgacagcccaatatcatattcaatgaagtgctct
gaaagcgaaggatcatccataagtattgacgatgcctatgataaatctgtgcatgacgct
tatcgaataaattcaataacttccaaggcaatgatacccgaagaaaatattgatgatgat
tttttagatagtaataaagtctcgcgaatcactggtaatcatagcacaaaaatgtaa

DBGET integrated database retrieval system