KEGG   Drosophila mojavensis: Dmoj_GI10672Help
Entry
Dmoj_GI10672      CDS       T01062                                 

Definition
GI10672 gene product from transcript GI10672-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI10672
   04150 mTOR signaling pathway
    Dmoj_GI10672
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 515 aa AA seqDB search
MHKLYLYYNCIGLNNLLNVVHRDSKMDFTDHLSQILVHDADIDNQCDRPSRAYSIGSKVE
HLKRNKLLGNINEVDNTSPRVRAYSVGSKSNIPRCEIQRGVVSKLKKGHIHKGSICNVDG
QTCTDRFGYNSPKEMKSTSAPLLNVRNFVSPVRMSDLMEIDFSNATPTSTSSQQLSLRNC
HVPKNVQAEFPIHKSAPIANPGLNGTSKLIRQNDLISKFRAPKSEENSESGYLEMKPVSM
VNTSFKQISIDEDQSEKLRTQSQFLLQLQARDEANNDNKISSEASEKNADLPESQYKTNI
NSEKSESIEKSHPESDLHTKMKNRLLNFALDISNATTAGRKLIHSISNEDYTKNLSKSNA
ADSNDVGYQILQIKSDSSLISKNKNQRPSYKPQCGRQNLLDGVNRMDKKEQVLNTNTKSN
LLKEKETNILNEETVSESVQNKNEKKLPSGVCEYELYYASLDLPQSSGQLATNCLKKVSC
ESPPIPSCFENTSSYAKIDFDQSDSSSASSKICNI
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcataaattatatttatattataattgtataggattaaacaatttactcaatgttgtc
cacagagactcgaaaatggattttaccgatcacttatctcaaatattagttcatgacgct
gatattgataaccagtgtgatcgtccaagccgagcttattcaattggaagtaaagtcgaa
cacctaaaacggaataaacttcttggaaatataaatgaagtcgataacacatcaccgcgg
gttcgagcatattcggttggatcaaagtcaaatataccacgttgtgaaattcaacgaggt
gttgtctccaagttaaaaaagggtcacattcataaagggagcatatgcaacgtagatggt
cagacatgcactgataggttcggatacaattctccaaaggaaatgaagtcgacgagtgcg
cctcttctaaatgtaagaaatttcgttagtccagtacgcatgagtgatttaatggaaatc
gatttctccaatgccactccaacatccactagttcacaacaattatcgttaagaaattgt
catgtacctaaaaatgtgcaagctgaattcccaattcataaaagtgcgcctatcgcaaat
ccaggtttaaatggaactagcaagctgatcaggcaaaatgacttgatcagtaaatttaga
gcacccaaatctgaagaaaactcagagagtggctatttagagatgaaaccagttagtatg
gtgaacacttcctttaaacaaataagcattgatgaagaccagagtgagaagttgaggact
caaagtcaattcctcttacagctgcaagcgcgggatgaagctaacaatgataataaaatt
tcctcagaagcgtcagaaaagaatgcagatttgccagagtctcaatataaaacgaacatc
aattcagagaaatcagaaagtattgagaaatcccaccccgaaagtgatttgcataccaaa
atgaaaaacagactattaaattttgccttagatataagtaatgcaactacagctggaaga
aagttaatacattcgattagtaacgaagactatacgaaaaatctaagtaaatcaaatgca
gctgattcaaatgatgtcggctaccaaattctgcaaatcaaaagtgatagttctctaatt
tcaaagaataaaaatcaaaggccatcctataagccacaatgtggtcgacaaaatcttcta
gacggtgtaaatagaatggataaaaaagagcaagttttaaatacaaacactaaatctaat
ttgttaaaggaaaaagaaacaaatattttaaatgaggagacggtatcagaaagtgttcaa
aataagaatgagaaaaagttaccttcaggcgtgtgcgaatatgaactttattatgcaagt
ttagaccttccacaaagtagcggacaattggcaacaaattgccttaagaaagtctcatgt
gaatctccgccaattccaagttgctttgagaacaccagctcatatgcaaaaattgatttt
gatcaatctgattcatcgtctgcttcgtcaaaaatttgtaatatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system