KEGG   Drosophila mojavensis: Dmoj_GI11077Help
Entry
Dmoj_GI11077      CDS       T01062                                 

Definition
GI11077 gene product from transcript GI11077-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dmo  Drosophila mojavensis
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI11077
Protein phosphatases and associated proteins [BR:dmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmoj_GI11077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgccgatgaaatt
cgtcgtttgggaaaacgttttcgaaaactcgatctcgataattcaggtgcactgagtatc
gatgaattcatgtcactgccggagctacagcagaatccgcttgtgcagcgtgttatcgat
attttcgatgccgacggcaatggtgaggtggacttcaaggagttcatccaaggcgtctca
cagttcagtgttcgcggcgataaactatcgaagttgcgtttcgcctttcgcatctacgat
atggacaacgatggctacatatcgaacggcgagctcttccaggtgctgaaaatgatggtc
ggcaacaatttgaaggatacgcaactgcaacagattgtcgacaagaccatttgctttgcc
gataaggatgaggatggcaagatctccttcgatgagttctgctctgtggtgggcaatacg
gatatacataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system