KEGG   Drosophila mojavensis: Dmoj_GI11083Help
Entry
Dmoj_GI11083      CDS       T01062                                 

Definition
GI11083 gene product from transcript GI11083-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 384 aa AA seqDB search
MDTPRRKLRNLHMENVQNNSTPIRIPPSPMLKTLGHGTGVSVYRLDRSPKLGRIRSPWAV
KRITQRTRAKKDTLFNDRIIHEAAILRKLNHPNIVGFRGVIKSSEGVDALALEMCSTSLG
SILEERHDEDLGPLPAKHTFKMIMDIAHALDFLHTEARLLHGDLKSFNVLVKGEFEICKL
CDFGVSLPLDENGEINFHKNPQLQYVGTQLWSPPEIMDEVDIIDSKADIFSFGLIIYETL
ALVPPHTLELDAAFNSSSIIDLENSQEQRRQLNYTDEGNMSVTDLDGSVKDANAAADALV
DTDEDDTKENDISDYSLSHVEQAYGTRPPLPVAFQLSDDYNCVVELFYLCTNAHSEDRPA
ARTIWQCFENNAANVVTASDSASD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccgcgtcgcaaactgcgcaacctgcacatggagaatgtgcaaaacaatagc
acaccgatccgaataccaccatcaccgatgctgaaaacacttggtcatggcaccggtgtc
agtgtctatcgcctggataggtcaccaaagctgggccgcatacgttcaccgtgggcggtc
aaacgcatcacacaacgcaccagggccaaaaaggatacgctgttcaatgaccgcatcata
cacgaagcagccattttgcgcaaactgaaccacccaaacatagtcgggtttcgtggcgtg
attaaatcgtcggagggcgtcgatgcactggccttggaaatgtgcagcacatcgctgggc
tccatattggaggaacgccacgatgaggatctcggaccgctgcccgccaaacatacattc
aaaatgatcatggacattgctcatgctctggactttttgcacaccgaggcacgtctgctg
cacggcgatctgaagtccttcaatgtcctggtcaagggcgaattcgagatctgtaaatta
tgtgattttggcgttagcctgcctctggacgagaatggcgagatcaactttcacaagaat
ccccagctgcaatatgtgggcactcaattgtggtccccgccagagataatggacgaggtg
gatattattgatagcaaagcagatatctttagtttcggcctgatcatctatgagacactg
gccctggtgccgccacacacgctggaactggacgccgccttcaatagcagctccatcatt
gacttggaaaactcgcaggagcagcgccgccagttaaactacacagatgagggaaacatg
agcgtcaccgatctagatggcagcgttaaggatgctaatgctgcggccgatgcccttgtg
gacaccgacgaggatgataccaaagagaatgacatctccgactattcgctcagtcatgtg
gagcaggcgtatggcacacgaccaccattgcccgtggcattccagctgagcgacgattac
aattgtgttgtcgaactgttctacttgtgcaccaatgcccacagcgaggatcgtccagcg
gcacgcaccatttggcagtgcttcgagaacaatgcggccaatgtggtcacagccagtgat
tcagccagcgattaa

DBGET integrated database retrieval system