KEGG   Drosophila mojavensis: Dmoj_GI11097Help
Entry
Dmoj_GI11097      CDS       T01062                                 

Definition
GI11097 gene product from transcript GI11097-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dmo  Drosophila mojavensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dmoj_GI11097
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dmoj_GI11097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 304 aa AA seqDB search
MEESLDVLVFGSAIIDFVCYAPRLPNPGETLHGTKFQTGFGGKGANQCVAATRLGSKTAL
IAKLGCDSFGNNYIRHLQAEKINVKHVQLLPDYTTGVAQIAVAHSGENNIIIVVGANNML
GPKDVENASYLFDKAKVLVCQLETPINGTLEALRRFKGISILNAAPAIADAPMELIQLCT
ILCVNETEAGILVGRHIDSINDAFNALAQLIHMGANIVIITLGKIGAVCSSRATRYDCQL
VSAPLVPPELTKDTTGAGDAFIGALAHSYAHFPEKALADHIASANVVASKSVQRLGTQSS
FPYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatcgcttgacgtgctcgtttttggctcggccattatagattttgtgtgctac
gcaccccgtttgcccaatcctggtgagactttgcatggtactaagtttcaaactggattc
ggtggcaagggcgccaatcaatgcgtagctgctactcgcctgggctccaagacagcttta
attgccaaactgggatgcgatagctttggcaacaattatatacgtcacctgcaggctgag
aaaataaatgtgaagcatgtccagctactgcctgactatacaacgggtgtagctcaaatc
gcagtcgcccattctggcgaaaacaacatcattatcgtcgtgggagccaacaatatgctc
ggccctaaggatgtggaaaatgcatcctatttgttcgacaaggccaaggtgttggtctgt
caactggagacgcccattaatggcacgttggaggcattgcgtcgattcaagggaatatcc
attttgaatgctgctccagccatagcggacgcccctatggagctgatacaattgtgcacc
attttgtgtgtgaacgaaaccgaagctggaatcctggtgggcaggcacatcgattccatt
aacgatgcattcaatgcattggcgcagttaattcacatgggcgccaacattgtaatcatc
acgcttggtaaaataggcgccgtctgttcctcgagagcaactcgttatgactgtcaactg
gtatcagctccattggtgcccccggagttgacgaaggacacaactggcgctggagatgcc
ttcattggtgccctggctcacagctatgcacattttccagaaaaagctctggctgatcac
attgcatctgccaatgtagtggcatctaagtcagtgcagcgccttggcacccagtcaagc
ttcccatatgcttaa

DBGET integrated database retrieval system