KEGG   Drosophila mojavensis: Dmoj_GI11129Help
Entry
Dmoj_GI11129      CDS       T01062                                 

Definition
GI11129 gene product from transcript GI11129-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dmo  Drosophila mojavensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dmoj_GI11129
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dmoj_GI11129
Glycosyltransferases [BR:dmo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dmoj_GI11129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 744 aa AA seqDB search
MAASVVKAPKCVAKAKDVAQTRPAQASDDNGRWWALLGLVLLFTFATRFYKVTEPDHICW
DETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNGTRYQGM
RYFCTTLGALIMPMGFDTVYDLTRSHEAALLSAAYLIFDVGLLTLNQYILLDPILLFFMM
GSVWGMVKISKCTAAGGSYTRRWWLWLLFTGTMLSCTISVKFVGLFVVLLVGLHTASELW
LILGDLEKPIVETVKQLACRAIALIVWPVLLYTIFFYIHLRVLNRSGHGDGFYSSAFQSR
LIGNSLYNASMPRDVAFGALVTIKNHKTGGGYLHSHSHLYPKGSGARQQQITTYTHKDDN
NIWLVKPYDQPAVPKGELRLLRHGDLLRLEHLVTKRNLHSHSEPAPMTKKHLQVTGYGEL
GVGDANDVWRVLIVGGKQNDTVHTVTSRLIFVHYLQSCVLTSSGKQLPKWGFEQQEVSCN
LNIRDKNAQWNVEDNQHKLLPSVSFSIYAPGFFARFLESHAVMLQGNAGLKPKEGEVTSR
PWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLLLFISIFLCNAILQQRRAGLAARQ
AAAVEQSATQELCSCCPAETLPEPTAVAVLSEQSPQRMSLQAAAWLFIGWLLHYLPFWAM
GRVLYFHHYFPALIFNSLLTGIMFNYIIRSLPRWLQHALLGSLLSALVYSFVLFSPLAYG
MSGPLANEPNSTMHKLKWLSTWEF
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgagtgttgttaaggcgcccaagtgcgtggcgaaagccaaagacgtggcccaa
acgaggccagcacaggccagcgatgacaatggacgctggtgggcattgctgggcctcgtt
ctcctcttcacctttgccactcgcttctacaaggtaaccgaaccggatcacatttgttgg
gatgagacgcactttggcaagatgggcagctggtacatcaatcgcaccttcttcttcgac
gtgcatccgccgctgggaaagatgttaatcggcctctctggctatttgaccggctacaat
gggaccttcccgttcgagaagcccggcgacaagtacaacgggacgcgatatcagggcatg
cgctatttctgcactacgctcggcgcactcatcatgccgatgggctttgatacggtctac
gatctgacgcgctcgcatgaggcggcgctgctgtcggcagcatacctgatcttcgatgtg
ggcctgctgaccctcaaccagtatatcctgctggatccgatactgctgttcttcatgatg
ggctcggtgtggggcatggtcaagatatcgaagtgcaccgccgccggtggctcctacacg
cgccgctggtggctctggctgctcttcactggcacgatgctctcctgcacgataagcgta
aagtttgtgggcctgttcgtggtgctgctggtgggcttgcacacggccagcgagctctgg
ctgatactgggcgacctggagaagcccattgtggagacggtgaagcagttggcgtgccgc
gccattgcgctcatcgtctggccggttctgctctacacgatcttcttctacatccatctg
cgtgtgctcaatcgcagcggccacggcgacggcttctacagctcggccttccagtcgcgc
ctcatcggcaactcgctgtacaatgcgagcatgccgcgggacgtggccttcggggcgctg
gtgaccatcaagaaccacaagacgggcggcggctacttgcactcgcattcgcatctctat
cccaagggcagcggcgcacgccagcagcagatcaccacgtacacgcacaaggacgacaac
aacatctggctcgtcaagccgtatgaccagccggcggtgcccaagggcgagctgcgcctc
ctgcgccacggcgacctcctccggctggagcacctggtgaccaagcgcaatctccactcg
cacagcgagccggcgcccatgaccaagaagcatctgcaagtgaccggctatggcgagctc
ggcgtgggcgatgccaacgatgtgtggcgcgtgctgattgtgggcggcaagcagaatgac
accgtccacacggtgacctcacggctcatattcgtgcactatctgcagagctgtgtgctc
acgtccagcggcaagcagctgcccaagtggggcttcgagcagcaggaggtctcctgcaat
ctgaacatacgcgataagaatgcccagtggaatgtggaggacaatcagcataagctgttg
cccagcgtaagcttcagcatctatgcgccgggcttctttgcgcgcttccttgaatcacat
gcggtcatgctgcagggcaacgccggcctcaagcccaaggagggcgaggtcaccagtcga
ccttggcaatggcccatcaactatcggggtcagttcttctcgggcagcagctatcgcatt
tacttgctgggcaatccgttgatctggtggagcaacctcgtctttctgctgctcttcatc
agcatctttctgtgcaatgccattttgcagcagcgccgcgccggcttggccgcccgccaa
gccgctgcagtcgagcagagcgccacgcaggagctgtgcagctgctgtccggcggagact
ctgccggagccaactgccgtcgccgtgctctccgagcagagcccgcagcgcatgtctttg
caggcagccgcctggctgttcattggctggctactgcactacttgcccttctgggccatg
ggtcgagtgctctacttccatcactacttccccgcactaatattcaattcactgctcaca
ggcattatgttcaactatataatacgatcgctgccccgatggctgcagcatgcgctgctc
ggctcgctcctctcggcgctcgtctacagcttcgtgctcttctccccgctggcctacggc
atgagcggacccctggccaacgagcccaactcaacgatgcacaagctcaaatggctctcc
acctgggagttttag

DBGET integrated database retrieval system