KEGG   Drosophila mojavensis: Dmoj_GI11219Help
Entry
Dmoj_GI11219      CDS       T01062                                 

Definition
GI11219 gene product from transcript GI11219-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dmo  Drosophila mojavensis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dmoj_GI11219
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dmoj_GI11219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 655 aa AA seqDB search
MSLQPSVQSAKCPMDVGAGQQHKEKQQQPQSLPPQPQSPQQKPAQRQRRSMQLLPVMLML
LLLTLLTRPLSVHSNRLSDTKLHEIFLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWF
YLGFSKRGGLADADICFFENQNGFFNVVTDTYTSPDGHWVRKDYQQDCEVFKMDEFTLAF
KRKFDTCDPLDLRLHEGTMYVVWARGESELALEDHQFALPNVTAPHEAGLKMLQLLRADK
ILIPETDLEQIEITLEQAPVPSQETTYWCHVQRLDDFVKNRMHIVQFEPIIKSPGIVHHM
EIFHCETDEHAEIPLYNGDCEQLPPAAKVCSKVMALWAMGASTFTYPPEAGLPIGGSGFN
PYVRLEVHFNNPELLEGLMDNSGFRIKLSKTLRQYDAGVMELGLEYTDKMAIPPGQTAFP
LSGYCVADCTRAALPKTGIIIFGSQLHTHLRGVRILTRHFRGEQELREINRDDYYSHHFQ
EMRTLHYKPRVLPGDALVTTCYYNTLGTANVTLGGFSISDEMCVNYIHYYPATKLEVCKS
SVSEETLEDYFIYMKRKEHQHGIHLNGARSANYRTIEWTQPHVDQLYTMYIQEPLSMQCN
RSDGQRFEGRNWEGVPPTPVQIKIPIHRKLCPNYNPLWLKPLEKGDCDLLGECIY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagccaagcgttcagtcggccaaatgcccaatggatgtcggcgcgggacaa
cagcacaaagagaagcagcaacagccgcagtcgctgccgccgcagccgcagtcgccgcag
caaaagccagcgcaacgacaacgtcgctcaatgcaactgctgccggtcatgttgatgttg
ctgctgctgacgctgctcacgcggccgctgagcgttcactcaaatcgtctctcggacaca
aagctacatgagatctttctggatgacaaggaaatcaagctgagctggatggttgactgg
tataagcaggaggtgctcttccatttgcagaatgcgttcaatgagcagcatcgttggttc
tatttgggcttttcgaaacgtggcggcttggccgatgcagatatttgtttctttgagaat
cagaatggcttcttcaatgtggtcaccgacacctacaccagccccgatggtcattgggtg
cgcaaggactatcagcaggactgcgaggtcttcaaaatggacgaattcacgctggccttc
aagcgcaagttcgatacctgcgatccgctcgatctgcgattgcatgagggcaccatgtac
gtggtatgggcacgcggcgaatcggagctcgctctggaggatcatcagttcgcgttgccc
aatgtgacggctccacacgaggcgggtctgaagatgttgcagctactgcgcgccgacaag
atcctcattcccgaaaccgacttggagcaaatcgaaatcacgctggagcaagcgccggtg
cccagtcaagagaccacttactggtgccatgtgcagcgtttggatgactttgtcaagaat
cgcatgcatatcgtgcagttcgagccaatcatcaagtcgcccggcattgtgcatcatatg
gagatcttccactgcgaaacggacgagcatgctgagattccactctacaacggcgactgc
gaacagctgcccccggcagccaaggtctgctccaaggtaatggcactgtgggccatgggc
gccagcacctttacgtatccaccagaagccggcctgccaatcggtggctccggcttcaat
ccctacgtgcggctcgaggtgcacttcaataatccagagctactggagggtctgatggac
aactctggatttcgcattaaattatcgaagacgctgcgacaatacgatgctggcgtcatg
gaattgggtctcgagtatacggacaaaatggcgataccgcctggccagacggccttccca
ctgagtggctactgtgtggcggactgtacacgggccgcattgccaaagacgggcatcatt
atatttggatcgcagctgcatacgcatttgcgcggcgttcgcatcctgaccagacacttc
cggggcgaacaggagctgcgggagataaatcgcgatgattactattcgcatcacttccag
gagatgcgcacgctgcactacaagccccgcgtcctgccgggcgatgcattggtcaccacc
tgctattataatacgcttggcactgcgaatgtcactctcggcggcttctccattagcgat
gagatgtgcgtcaactatatacactactatccggccaccaagctggaggtgtgcaagagc
tctgtttcggaggagacactcgaggattattttatctatatgaagcgaaaggagcatcag
catggcatacacctgaacggagcacgttcggcgaattatcggactatcgaatggacccag
ccgcatgtggaccaattatatacgatgtacattcaggagccgctcagcatgcagtgcaac
cgatccgatggccagcgctttgaggggcgcaattgggagggcgtgccaccgacgccagtc
caaatcaaaatacccattcatcgcaagctctgccccaactacaatccgctctggctgaag
cccctggagaagggcgactgcgatttgctaggcgagtgcatctactag

DBGET integrated database retrieval system