KEGG   Drosophila mojavensis: Dmoj_GI11295Help
Entry
Dmoj_GI11295      CDS       T01062                                 

Definition
GI11295 gene product from transcript GI11295-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dmo  Drosophila mojavensis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dmoj_GI11295
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmoj_GI11295
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dmoj_GI11295
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dmoj_GI11295
   00511 Other glycan degradation
    Dmoj_GI11295
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI11295
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dmoj_GI11295
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI11295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 678 aa AA seqDB search
MSGGSGGFRCNRKLTLAMSGGFIILVIALTVGLCVGLSGSNDVTENEETTSFSIDHQANT
FLLNGKPFRYVAGSFHYFRALPEAWRNRLRTMRAAGLNALDTYVEWSLHNPHDGEYNWEG
IADLVKFLEIAQEEDFYIVLRPGPYICAERDNGGLPHWLFTKYPDIKVRTNDPRYIAEVS
KWYAELMPRLKHLLIGNGGKIIMVQVENEYAAYYACDHDYLNWLRDETDKYVENKALLFT
VDIPNERMHCGKIDNVFATTDFGIDRIHEIDQIWKYLRSVQPTGPLVNSEFYPGWLTHWQ
EMNQRRDPQEVASALKTILSYNASVNLYMFFGGTNFGFTAGANYDLDGSIGYTADITSYD
YDAVMDEAGGVTKKYELVKQVIGEVLELPNIVLNPAKRLAYGKVELTPTTELLSAEGRAA
LAKGAPVKSTKPKSFEEMDQYSGLLLYETPLPSLDLDPTLLQVEDLRDRAHVFVDQQLVG
TLSREARIYALPLSKGWGSTLQLLVENQGRINYDRANDTKGIFGKVTLQLHNGGALPLED
WTTTAYPLEAITIENWRQKLPENAALDSSIAKQRLLRSGPILYTGSFQVSEVGDTYLNPA
GWGKGVAYVNGFNLGRYWPLGGPQITLYVPNELLKVGSNSLVLIEYQRCNKTTNGPELPA
VQFDAVAQLDGESSEAQK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcggcagtggcggctttcgctgcaatcgcaagctaacgttggccatgagcggc
ggctttataattttggtgatcgcactgacggtcggcctctgtgtggggctcagcggcagc
aatgacgtcacagagaatgaggagacaacttctttcagcattgatcaccaggcaaacact
ttcctcttgaatggaaaaccatttcgttatgtcgccggctcatttcattatttccgggct
ctgcctgaggcttggcgtaatcgtctgcgcaccatgcgtgcagctggtctcaatgcattg
gatacctacgttgagtggtcgctgcataatccgcacgatggtgaatacaattgggagggc
atagccgatttggttaaatttctggaaatagctcaagaagaggacttttatatagtgctg
cgtcccggtccatatatctgtgctgagcgcgataacggcggtctaccccactggctgttt
acaaaatatccggacatcaaagtgcgcacaaatgatcccagatatatagccgaggtcagc
aaatggtatgcagagctaatgccacgcctgaagcatttgcttatcggcaacggcggcaag
atcataatggtgcaagtcgagaacgaatatgcggcatactatgcctgcgatcatgattat
ctgaattggttgcgcgacgagaccgataaatatgtggaaaataaagcgctactgttcact
gtggacattccaaatgaacggatgcactgcggaaagattgacaatgtatttgccaccacg
gactttggcatcgatcgcatccatgagattgatcaaatctggaaatatctgcgcagcgta
cagcctactggaccattggtcaactcggagttctacccaggctggctcacccactggcag
gagatgaatcagcgacgtgatccgcaggaagtggccagcgctttaaagaccatactcagc
tacaatgccagcgtcaatctatacatgttctttggcggcacaaatttcggttttacagcc
ggcgccaattacgatctggatggcagcattggctatacggcggacatcaccagctatgac
tacgatgcggttatggatgaggcgggcggagttaccaaaaagtatgagctagtcaagcaa
gtgataggcgaggtactggagctgcccaacattgtgctaaatcccgccaagcgtttggca
tatggcaaagtggagctgacacccacaacggagctgctgtcggcggagggacgcgctgcc
ctggccaagggcgcgcccgtcaagtccacgaaacccaagtcctttgaggaaatggatcag
tattcgggcctactgctgtacgagacaccactgcccagcttggatctggatccaacgctg
ctgcaggtggaagatttacgtgatcgagcgcacgtctttgtcgaccaacagctggtgggc
acattgtcccgggaggcgcgcatctatgcgctgcccctgagcaagggctggggcagcacg
ctgcagctgctcgtcgagaatcaggggcgcattaactatgatcgtgccaacgacaccaaa
ggcatctttggcaaggtgacgctccagctgcacaatggcggcgccttaccgctggaggat
tggacaacgacggcctatccactggaggccatcaccattgagaactggcgccagaagttg
ccagaaaatgcggccctcgactcgtcgatagccaagcagcgactgctacgctccggaccc
atactctatacgggcagctttcaggtgtccgaggtgggcgacacctatctgaacccggct
ggctggggcaagggtgtggcctatgtgaatggcttcaatttgggacgctattggcctctg
ggcggaccccagataacgctctatgtgcccaacgagctgctcaaagtcggatccaattcc
ctggtgctgatcgagtatcaacgctgcaataagaccacaaatgggccagagctgccggcg
gtccaatttgatgcagttgctcagctggatggagagtccagcgaggcacagaagtag

DBGET integrated database retrieval system