KEGG   Drosophila mojavensis: Dmoj_GI11297Help
Entry
Dmoj_GI11297      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dmoj_GI11297
Protein kinases [BR:dmo01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dmoj_GI11297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like SDA1 Serinc APH
Motif
Other DBs
NCBI-GeneID: 6583662
NCBI-ProteinID: XP_002009327
FlyBase: FBgn0134058
UniProt: B4KY84
Position
Unknown
AA seq 495 aa AA seqDB search
MSISTCARFCSSLTGMSKNLASSKNGSSSKLIEGAETCVTQWAALQNKKEIPTTSTSSDN
TEATFTFKLGRTTGGDLSSNLSVTSSESSDILESDYSEKSGEQNSQKLQSPYVGVRSSSN
NNVTTFVDHKLVHKEEKDESHDAADIKCKDSEKSELDDGNDTDEDETDNESEESSSNHTE
KSGRKYNFDHFQIIKTVGTGTFGRVCLCRDRVSNKYCAMKILTMAEVIRLKQIEHVINER
NILREIRHPFVISLKWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFSSQTSEIVSALEYL
HSLQIIYRDLKPENLLINRDGHIKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNK
AVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDR
TKRLGNMKNGADDVKRHRWFKNINWNDVYNKKLKPPILPDVHHDGDTKNFDDYSEMDWKP
TIAIDQKDFKLFNDF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatcaacctgtgcgcgattttgcagttcactcacaggtatgagcaaaaattta
gcatcatctaaaaacggttcctcgtccaagctaatagaaggagctgaaacatgcgtgaca
caatgggcagctctgcagaacaaaaaagaaattccaacaacaagcacctcatcagataac
acagaggcaacatttacatttaaattgggccgaacaaccggcggtgatttgagcagtaac
ctcagtgtgacctctagtgaatcttcggatattctagaatcagactatagtgagaaaagt
ggagaacaaaattcacaaaaattgcaaagcccgtatgtcggtgtcagaagttctagtaac
aacaacgtcacaacatttgttgatcataaactcgttcataaagaagaaaaggacgagagt
catgatgcagctgacataaaatgtaaggattccgaaaagagcgaactagatgacggaaat
gacactgatgaagacgaaacagacaatgaatccgaagagagtagcagcaatcacactgaa
aagagtggacgtaaatataattttgatcattttcagattattaaaaccgtcggcactggt
acatttggacgtgtctgcctctgtcgtgatcgtgtttcgaataaatattgtgccatgaaa
attttaacaatggcggaagtcattcgactaaaacaaattgaacacgtaataaatgaacga
aatatattgcgtgaaatacgtcacccatttgttatatctttaaaatggtctacaaaagat
gattccaacctatacatgatcttcgattatgtttgtggaggcgagctgttcacatatctg
cgaaatgcggggaagttttctagccaaacttcagaaattgtaagcgctcttgaatatcta
cactcactacaaattatatatcgagacttgaaaccagaaaatctgttaataaatagggat
ggtcatataaagataaccgattttggatttgctaagaaactccgtgatcggacgtggaca
ttatgcggcacacccgagtatatagcaccagaaataatacaatctaaaggccataataag
gcagtcgactggtgggcgttaggcgtattgatttatgaaatgcttgtgggctatccgcct
ttttatgatgagcagccatttggaatctatgaaaaaatattaagcggcaaaattgaatgg
gagcgccatatggatcccattgctaaagatttaataaaaaagttattggtgaatgataga
acaaagaggctggggaatatgaagaatggagctgatgacgttaagaggcatcgctggttc
aagaacattaattggaatgatgtatataataaaaaactaaagcccccaattttacctgat
gtacatcatgatggggatacaaagaattttgatgattattccgaaatggattggaagcct
actattgcaatagaccaaaaagattttaaattatttaatgatttctaa

DBGET integrated database retrieval system