KEGG   Drosophila mojavensis: Dmoj_GI11304Help
Entry
Dmoj_GI11304      CDS       T01062                                 

Definition
(RefSeq) GI11304 gene product from transcript GI11304-RB
  KO
K05759  
profilin
Organism
dmo  Drosophila mojavensis
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI11304
Cytoskeleton proteins [BR:dmo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dmoj_GI11304
Exosome [BR:dmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmoj_GI11304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVNKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtcgataaccaacttttggcctcgcagtgcgttaacaaggcg
tgcattgccggacacgatggcaacatttgggcgcagtctaacggctttgaggtcacaaag
gaggagctggccaaattgataagcggctttgatcaacaagacctgcttaccagcaacggt
gtgacattagccggccaacggtacatttatctctcaggcacagatcgcgtggtgcgcgca
aaactgggcagaagcggtgtgcactgcatgaagacgacacaagccgtcattgtttccatc
tacgaggatcctgtgcaaccccagcaggccgcttctgtggtggagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system