KEGG   Drosophila mojavensis: Dmoj_GI11427Help
Entry
Dmoj_GI11427      CDS       T01062                                 

Definition
GI11427 gene product from transcript GI11427-RA
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI11427
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI11427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 849 aa AA seqDB search
MSWTNSAQHKKSTQSVAVTASPNTVNNGATVAAGAGPAAAATSGATATSTGGGFNKPSST
VGGGIYSHPTKTYTNQQHYQQQQQHYQGNYSSNNSSNNSNSSSTSNNNSQPQVRTYGTMK
VPSSPVASSAPSLERKISGQQQQQSQQLGNSNTTTTATTSTASITATPQQFQQQTSTESL
SNSTNNATVPPQQQQQQPQQQHGQYAPAAKAYASYGVKSRNITQNSSTDASFSAAATAAA
VQPALNLAPPAPPASQSASSADSGQPSWASLFSSKKPVAKVAPYEGNKSQQQQQQQQQQQ
QQQLQQPQPQQSSQMPVVPPQSQAAPQQLPAPQQQVAFASPSQNLPNVHHQLQSPTPVPA
PTGPLITPGALSYSAASAQAVPASVAPPASAAVKPLKGEPSRAAQLDEWTNKYADFLIRY
KTNLTPISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVMSEVKTPTVNA
MMSYMSNFSSLPSGTRLRLNNKAAQIKGKDEFAGVDLQCDLAFEPTEIYKLWNDSREEHV
EGRQEDAEEFLGYVLNKLNDEMLEIIKLIAKPNAQQNGVEQEQEIEDGGDDWQMICNNRN
KGSITRQTDFGRTPLSDIFRGELRSRLQREGEHSTDVIQPFFTLQLNIEKAASVKEALEI
LVGRDQLEGVTGSKSKQEVVAWQQMTVEKLPIVLILHLKYFDYRSDGCTKILKKVEFPVE
LKIDAKILGSKKTSQKQRTYRLFAVVYHDGKEASKGHYITDVFHTGYNNWLRYDDSSVKP
IGEKQVLQPHTPRVPYLLYYRRFDTLPQVQASNGGGAGNAVGATNSHAHAHASANPASTT
AAANSANNK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggacaaactccgcccagcacaagaagtccacgcagtcggtggcggtcacagca
tcgcccaacactgtaaacaatggggcaactgttgctgcgggtgcaggtccagctgctgct
gctacaagtggagcaactgcaacatccactgggggcggcttcaataagccgtccagcacc
gttggcggcggcatctacagtcatcccaccaagacctacaccaaccagcagcattaccag
caacagcagcagcactatcagggcaactacagcagcaacaacagcagcaacaacagtaac
agcagcagcactagcaacaacaacagtcagccacaggtgcgcacatatggcacgatgaag
gtgccctcatcgcctgttgcaagctcggctccatcgctggaacgcaagattagtgggcag
caacagcagcagtcacaacagctgggcaacagcaatacaacaacaacagcaactacctca
acggctagcatcactgcgacgccgcaacagtttcaacaacagacgtccactgaaagtctg
tccaacagcacaaacaatgcaacagtaccgccgcagcaacaacaacaacagccgcagcag
caacatggccaatatgctccagctgccaaagcctatgcgagctatggagtcaagtcaaga
aacatcactcaaaactcgagcacagacgcctccttcagtgcagctgcaactgctgcagct
gtgcagccggcgctgaacttggcgccacccgcaccgcctgcttcgcagagcgccagcagc
gcggacagcggccagccctcttgggccagtctcttctccagcaagaagcccgtggccaag
gtggcgccctacgagggcaacaagtcccagcagcagcagcagcagcagcagcagcagcaa
cagcaacaactgcagcaaccacagccgcagcagtcgtcgcagatgccagtggtgccacca
cagtcacaagcagcaccacagcaattgcctgcgccacaacagcaagtggcctttgcgtcg
ccttcgcagaacctgcccaacgttcatcatcagttgcagtcgccgacgccggtgccggcg
ccaactggcccgctcatcacaccgggcgcactctcctattcggcggcctcggcacaggct
gtgccggcctctgtggccccacccgcctcggcagctgtgaagccgctgaaaggggagccg
tcgcgcgccgcccagctcgacgagtggaccaacaaatacgccgacttcttgatacgttac
aaaaccaacctgacgcccattagcctgcggccgcgtggcctgactaaccgatccaattac
tgctacattaactcgatactgcaggcgctgctcggctgttcgcccttctacaatctgctg
cgctccatacccaagcaggcggcggtgatgagcgaggtcaagactcccacagtgaacgcc
atgatgtcgtatatgagcaacttttcgtcgctgccgagcggcactcgcctgcggctgaac
aacaaagctgctcagatcaagggcaaggatgaatttgccggcgttgatctgcagtgcgat
ttggcatttgagcccacggaaatctacaaactgtggaacgacagccgcgaggagcacgtg
gagggcagacaggaggatgctgaagagttcttgggctacgttctcaacaagctgaacgat
gagatgctcgagattatcaagctgattgccaagccaaatgcccaacagaatggtgtggag
caagaacaggagatcgaggatggaggcgacgattggcagatgatctgcaacaatcgcaac
aagggcagcattacgcgtcaaactgatttcggacgcactccgctgagcgatatcttccgg
ggtgaattacgttcgcgacttcaacgtgagggcgagcactccacagatgttatacagccc
ttctttacgctccaattgaacattgagaaagcggcctcggtgaaggaggctctggagata
ctcgtgggtcgcgatcagctggagggcgtcactggcagcaagagcaaacaagaggtggtc
gcctggcagcaaatgacggtggaaaagttgcccatcgttttgatattgcatttaaaatac
tttgactacagatccgatggctgcacaaaaatactgaagaaggtcgagttccctgtggag
ctcaaaatcgatgccaaaatactcggctcgaaaaagacgtcgcagaagcagcgcacctat
cgtctgtttgcggtggtctatcacgatggcaaagaggcctcgaagggccactacataacg
gatgtgtttcataccggctataacaactggctgcgctacgatgacagctcggtgaagccg
atcggcgagaagcaagtgctgcaaccgcacacgccgcgtgtgccttatctactctactat
cgccgcttcgataccctgccgcaggtgcaggctagcaatggcggtggtgccggcaatgca
gtaggcgccaccaactcccacgcacatgcccatgcctcagccaatcccgcgtccaccaca
gcagctgctaactcagcgaataataaatga

DBGET integrated database retrieval system