KEGG   Drosophila mojavensis: Dmoj_GI11531Help
Entry
Dmoj_GI11531      CDS       T01062                                 

Definition
GI11531 gene product from transcript GI11531-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dmoj_GI11531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 682 aa AA seqDB search
MASEQAPIDVAGAAAAAAATGDEPFLGLLDVALLTVLIGGAAFYFLRSRKKEEEPVRSYS
IQPTTVSTTMTTDNSFIKKLKTSGRSLVVFYGSQTGTAEEFAGRLAKEGIRYRLKGMVAD
PEECDMEELLHLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITNGDVDLTGLNYAVFGL
GNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGI
EGSGEEVLIRQYRLLEQPDVLPDRIYTGEIARLHSMQNQRPPYDAKNPFLAPIRVNRELH
KGGGRSCMHIELSIEGSKMRYDAGDHVAMYPINDKSLVEKLGQLCNADLDTVFSLINTDT
DSSKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCSDEADKELLRSMASLAPEGK
EKYQSWIQDACRNVVHILEDIKSCKPPLDHICELLPRLQPRYYSISSSAKLYPTDVHVTA
VLVEYKTPTGRVNKGVATTYLKNKQPTAGEEVKVPVFIRKSQFRLPTKPETPIIMVGPGT
GLAPFRGFIQERQYLRDEGKTVGQSVLYFGCRKSTEDYIYESELTEWVNKGTLTLKTAFS
RDQEKKVYVQHLLEQDADLIWDIIGEKKGHFYICGDAKNMAVDVRNILTKILSNKGNMSE
ADAVQYLKKMEAQKRYSADVWS
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaacaggcacccattgatgtagctggagcggcagcggcagctgctgccacc
ggagatgagccctttctgggattgttggatgtggcactgctgacggtgctgatcggcggt
gcggccttctactttctgcggagccgcaagaaggaggaggagcccgtgcgcagctactcc
atacagccaaccacagtcagcaccaccatgaccacggataattcgtttattaagaaactc
aaaacctccggccgcagcttggttgttttctatggctcacagacgggcacggctgaggag
ttcgccggccgtttggccaaagagggtattcgttatcgactcaagggcatggtcgccgat
cccgaggaatgcgatatggaggagctgctgcacctgaaggacattgataattcattggcc
gtgttctgcttggccacctacggcgagggtgatcccacggacaatgccatggagttctac
gaatggatcactaatggtgatgtcgatctaacgggtcttaattatgcggtatttggcctg
ggcaataagacctatgagcactacaataaggtggccatctatgtggacaagcgcctggag
gagctgggcgccaatcgggtcttcgagctgggtctgggcgacgacgatgccaacattgag
gatgattttatcacgtggaaggatcgtttctggcccgctgtctgcgatcactttggaatt
gagggcagcggcgaggaggtgctgatacgccagtaccgcctgctcgagcagcccgatgtg
ctgccggatcgtatttataccggtgaaattgcgcgtctgcattccatgcagaatcagcgt
ccaccgtacgatgccaagaatccattcctcgctcccattcgtgttaaccgtgaactgcac
aagggcggcggtcggtcatgcatgcacatcgagctgagcattgagggctcgaagatgcgt
tacgatgccggcgatcatgtggccatgtatcccatcaacgacaagtcgctggtggagaaa
ctgggacagttgtgcaacgctgacttggatacggtgttctcattgatcaataccgatacg
gatagtagcaagaagcatccattcccctgcccaaccacctatcgtactgctctgacgcac
tatttggaaatcactgctattccacgcactcacatactgaaggagttggccgagtactgc
tcggatgaggccgacaaggagctgctgcgcagcatggcctcgctggcaccggaaggcaag
gagaagtatcagagttggattcaggatgcctgccgcaatgtggtgcacatattggaggat
atcaagtcgtgcaagccgccgttggatcatatttgtgagctgttgccacgcctgcagccg
cgctactattccatttcgtcgtcggccaagctgtatccaacggatgtgcatgtgaccgct
gtgctggtcgaatacaagacgcccacgggtcgtgtcaacaagggcgtggccaccacatac
ctaaagaacaaacagccaaccgctggcgaggaggtcaaagtgccggtgttcatacgcaaa
tcgcaattccgactgcccacgaaaccggagacaccgatcataatggttggtccgggcact
ggactggcaccgttccgtggcttcatccaggagcgtcagtatttgcgtgatgaaggcaaa
acggttggccagtcggtgctttactttggctgccgcaagagcaccgaggactacatctac
gagtccgagctgaccgaatgggtcaataagggcacgctcaccttgaagacggcgttctcg
cgtgaccaggaaaagaaggtttatgtgcagcacttgctggaacaggatgccgatctgata
tgggatatcattggcgaaaagaagggacatttctatatttgcggtgatgccaagaacatg
gctgtggatgttagaaatattctaacgaaaatcttgtccaacaagggcaacatgagcgag
gcggatgctgtgcagtatctgaagaaaatggaggctcagaaacgctattcggccgatgtc
tggagctaa

DBGET integrated database retrieval system