KEGG   Drosophila mojavensis: Dmoj_GI11552Help
Entry
Dmoj_GI11552      CDS       T01062                                 

Definition
GI11552 gene product from transcript GI11552-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dmo  Drosophila mojavensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI11552
   00052 Galactose metabolism
    Dmoj_GI11552
Enzymes [BR:dmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dmoj_GI11552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 377 aa AA seqDB search
MTVTITEEIFGLAKNPFTKVPEMVRRYTMTNQNKMSVSVIQLGAIIQSVCMPDAYDKIED
VCLGFDDIASYVNAKHAYIGGTLGRVANRVANGSYTVGETKYELTKNFMDTYQLHGGFVG
FDSVIWEVARKSDIMGITFKHVSPDGHEGYPGNLTVTVTYWLDNQNRLGIRYEAFTDKTT
PINLSNHAYFNLAGHNAGFKGLAEHTVEIASKRIIDTDDDQIPTGEFLDVDDTVFDMRIP
VLIGDRLKQFDNRLIKGYDNCFVVNEGKEGVNLIGKLAHPPSGRALEIYSNQPGLQFYTA
NNLPDEEKGDAPMIGKECSHYRKHGSFCVETEKFPDAVNHQNHDFPSIFLNPNEKYNHEV
IYKFVVEQSWKCCCNNK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacaatcacggaagaaatctttggcctggcaaagaatcccttcaccaaagtg
cccgaaatggtgcgtcgctacacaatgaccaatcagaacaagatgtccgtttcggtcata
cagctgggcgccatcatccagagcgtctgcatgccggatgcctatgacaagatcgaggac
gtgtgccttggcttcgacgacattgccagctacgtgaatgccaagcacgcgtatattggc
ggcactctgggccgtgtggcgaaccgggtggccaatggctcgtacactgtgggcgagacc
aagtacgaactaacgaagaacttcatggacacgtatcagctgcacggcggctttgttggc
ttcgatagcgtcatctgggaggtggcacgtaaatcagatataatgggtattacgtttaag
catgtatcgcccgatgggcacgagggctatccgggcaatttaactgtcactgtaacgtat
tggctggacaaccagaaccgattgggtatacgctacgaggcgtttaccgacaaaacgact
cccatcaatctgtccaatcatgcctacttcaatttggctggccacaatgccggcttcaag
ggactggcggagcataccgtggagatagcgtccaagaggattatcgatacggatgacgac
caaatcccgaccggtgaattcttggatgtggatgacacggtctttgatatgcgtataccc
gtgctgattggagatcggctgaagcagttcgataatcgtctaatcaagggatacgacaac
tgctttgtggtcaacgagggcaaggagggcgtcaatctgattggcaagctggcccaccca
cccagcggccgcgccttggagatttattcgaatcagccgggtctgcagttctacacggcc
aacaatttgccggacgaggagaagggtgatgctcctatgattggcaaggagtgttcgcat
tatcgcaagcacggctcattttgtgtggaaaccgagaaatttccggatgctgtcaaccat
caaaatcacgactttccctccatatttctcaatcccaacgaaaagtacaaccatgaagtc
atatacaagtttgtcgtcgaacagtcctggaaatgctgttgtaataacaaataa

DBGET integrated database retrieval system